(data stored in ACNUC7421 zone)

EMBL: CP001600.PE55

CP001600.PE55        Location/Qualifiers
FT   CDS_pept        50262..50429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0057"
FT                   /product="50S ribosomal protein L33, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67317"
FT                   /db_xref="GOA:C5B9D7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D7"
FT                   /protein_id="ACR67317.1"
FT                   /translation="MAKGIREKIKLVSSAGTGHYYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVIYKEAKIK"
     atggctaaag gtattcgcga gaagatcaag ctggtttcct ctgctggtac tggtcactac        60
     tacaccacta ccaagaacaa acgtaccaaa ccggaaaaat tggaactgaa aaagttcgat       120
     ccggtggtac gccagcatgt gatctacaaa gaagctaaaa ttaaataa                    168
//

If you have problems or comments...

PBIL Back to PBIL home page