(data stored in ACNUC7421 zone)

EMBL: CP001600.PE550

CP001600.PE550       Location/Qualifiers
FT   CDS_pept        579040..579468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0592"
FT                   /product="50S ribosomal protein L13, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67821"
FT                   /db_xref="GOA:C5B747"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B747"
FT                   /protein_id="ACR67821.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRLDKKYFHHTGHIGGIKEATFEEMIARHPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI"
     atgaaaactt ttacagctaa accagaaacc gtaaaacgcg actggtatgt tgttgatgct        60
     agcggcaaaa ctttaggccg tttggcaact gaactggctc gtcgcctgcg cggcaagcac       120
     aaggcggagt ataccccgca tgtggatacc ggtgattaca tcatcgttct gaacgcagaa       180
     aaagttgccg taaccggtaa caagcgtctg gacaagaagt atttccacca tactggccac       240
     atcggcggta tcaaagaagc gacctttgaa gagatgattg ctcgccatcc tgagcgtgta       300
     attgaaatcg cggttaaagg catgctgccg aaaggcccgc tgggtcgtgc aatgttccgt       360
     aaactgaaag tttacgcggg caacgagcac aatcacgcgg cgcagcaacc gcaggttctg       420
     gacatttaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page