(data stored in ACNUC7421 zone)

EMBL: CP001600.PE551

CP001600.PE551       Location/Qualifiers
FT   CDS_pept        579483..579875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0593"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67822"
FT                   /db_xref="GOA:C5B748"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B748"
FT                   /protein_id="ACR67822.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGKIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
     atggctgaaa atcaatacta cggcactggt cgccgcaaaa gctccgccgc tcgcgtattt        60
     atcaaaccgg gtagcggtaa aatcgttatc aaccagcgtt ctctggaaca gtacttcggt       120
     cgcgaaactg cccgcatggt agttcgtcag ccgctggaac tggtcgacat ggttgaaaaa       180
     ctggatctgt acatcactgt taaaggtggt ggtatctctg gtcaggcagg tgcgatccgt       240
     cacggtatca cccgcgctct gatggagtac gatgagactc tgcgctccga actgcgtaaa       300
     gctggcttcg tcactcgtga cgctcgtcag gttgaacgta agaaagttgg tctgcgcaaa       360
     gcacgtcgtc gtccgcagtt ctccaagcgt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page