(data stored in ACNUC7421 zone)

EMBL: CP001600.PE552

CP001600.PE552       Location/Qualifiers
FT   CDS_pept        579902..580027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67823"
FT                   /db_xref="UniProtKB/TrEMBL:C5B749"
FT                   /protein_id="ACR67823.1"
FT                   /translation="MLKTRLSRVFLFPYGIGLFAVKDFIHKIIICHPQARQFLVD"
     atgctaaaaa cccggctaag ccgggttttt ttattcccat atggcattgg cttattcgct        60
     gtaaaggatt ttatccataa aatcattatc tgccacccac aagcacgcca atttctggta       120
     gactga                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page