(data stored in ACNUC7421 zone)

EMBL: CP001600.PE553

CP001600.PE553       Location/Qualifiers
FT   CDS_pept        580210..580851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0595"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67824"
FT                   /db_xref="GOA:C5B750"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5B750"
FT                   /protein_id="ACR67824.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVDMGN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLFMH
FT                   QIERDWYSLLYKIEKGSAQEADAARKQLREELLAIAPVFSQKPFFMSDEFSLVDCYLAP
FT                   LLWRLPVLGIELSGAGAKELKGYMTRVFERDAFLASLTEVEREMRLHTRG"
     atggctgtcg ctgccaacaa acgttcggta atgacgctgt tttccgggcc gaccgacatc        60
     tttagccatc aagtacgtat tgtcctggct gagaagggtg tcagcgtcga gatcgagcag       120
     gtggatatgg gcaatctgcc acaggatctg atcgacctca acccctatcg cacggtgccg       180
     acgctggttg accgcgagct gacgctgtat gaatctcgca tcatcatgga gtaccttgat       240
     gagcgcttcc cacatccgcc gctgatgccg gtctacccgg ttgcccgtgg tgagagccgc       300
     ctgtttatgc accagatcga gcgtgactgg tactccctgt tgtataagat cgagaaaggc       360
     agcgctcagg aggcggacgc cgcccgtaaa cagctgcgtg aagagctgct ggctatcgct       420
     ccggtcttct cccagaaacc gttttttatg agcgatgagt tcagtctggt ggactgctat       480
     ctggcaccgc tgctgtggcg tctgccggtg ctgggcatcg agctgagtgg cgccggtgcc       540
     aaagagctga aaggctatat gacacgcgtc tttgagcgcg atgctttctt ggcctcgcta       600
     accgaggttg agcgtgaaat gcgtctgcat acccggggct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page