(data stored in ACNUC7421 zone)

EMBL: CP001600.PE554

CP001600.PE554       Location/Qualifiers
FT   CDS_pept        580869..581345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0596"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67825"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C5B751"
FT                   /protein_id="ACR67825.1"
FT                   /translation="MSPRRPFLLRAFYDWLLDNQLTPHLVVDVHCAGVMVPMEYARDGQ
FT                   IVLNIAPRAVGALELADDAVRFNARFGGVPRQVYVPMAAVMAIYARENGAGTMFEPEAA
FT                   YEQDTDETRIEAENDEPPMMLIDGDRSPDNKAPADDDGGDEPPPRGRPALRVVK"
     atgtcaccgc gccgtccctt cctgctgcgc gctttttatg actggctgtt ggataatcag        60
     ctgacgccgc acttggtggt ggatgtgcac tgtgccggtg tgatggtgcc gatggaatac       120
     gcgcgcgatg ggcagattgt cctgaatatc gctccacgcg ccgtcggtgc gctggagctg       180
     gccgatgatg cggtgcgctt taacgcccgc ttcggcggcg tgccgcgtca ggtatatgtg       240
     cccatggcag cggtgatggc tatctatgcg cgtgaaaacg gtgccggtac gatgtttgag       300
     cctgaagctg cctatgaaca ggataccgat gagacccgca tcgaggcgga gaacgatgag       360
     ccgccaatga tgttgatcga tggcgatcgc tcgccggata acaaggcgcc cgctgacgat       420
     gacggcggcg atgagcctcc gccgcgtggc cgtccggccc tacgcgtggt taaataa          477
//

If you have problems or comments...

PBIL Back to PBIL home page