(data stored in ACNUC7421 zone)

EMBL: CP001600.PE555

CP001600.PE555       Location/Qualifiers
FT   CDS_pept        complement(581555..582031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0597"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67826"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:C5B752"
FT                   /protein_id="ACR67826.1"
FT                   /translation="MILGHLDDLTQRGDLPNPIRRALQRALEAGAAHLENGTHPIDGEQ
FT                   LYMNVMTLTPLGAEEKLGEIHRDYLDIQLVLQGEERIDFAMAGQARECQPYQQEGDYQL
FT                   CAAMMQPQRLIMTPGMFAVFLPGEPHKPGCISRTSDPIRKVVVKLHRDCLKEEK"
     atgatacttg gacatcttga tgatttaacc cagcgcggcg acctaccgaa tcccattcgc        60
     cgggcgctgc agcgcgcgct ggaggccgga gcagcacatc tggaaaacgg cacccacccc       120
     atcgatggag agcagctgta catgaatgtc atgacgctga cgccactggg ggcggaggag       180
     aaactgggcg agatacaccg cgactatctg gatattcagc tggtgctgca gggcgaagag       240
     cgcatcgact ttgccatggc gggccaggcg cgcgaatgcc aaccgtacca gcaggaagga       300
     gactatcagc tgtgtgccgc catgatgcag ccgcagcgcc tgatcatgac gccggggatg       360
     tttgcggtct ttctccccgg agagccccat aagcccggct gtatcagccg gacgtcagac       420
     cccattagga aagtcgtcgt caagctgcac cgcgactgtc ttaaggaaga gaaataa          477
//

If you have problems or comments...

PBIL Back to PBIL home page