(data stored in ACNUC7421 zone)

EMBL: CP001600.PE556

CP001600.PE556       Location/Qualifiers
FT   CDS_pept        complement(582028..582903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0598"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67827"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C5B753"
FT                   /protein_id="ACR67827.1"
FT                   /translation="MNTLAIDLGGTKLAAALVDANGQLSQRSEVATPVSGDPEALTKAL
FT                   SQLVTRYRGMAGRVAVASTGIIHQGILSALNPDNLGGLDRFPLQECIERLSALPCYLLN
FT                   DAQAAAWSEYLTLTPSGQDMAFITVSTGVGGGLVLNGRLQIGRGAFAGHIGHTLADPAG
FT                   PRCGCGRSGCVESIASGRAIAAAAQGDLTGLDARAIFQRAAADDAQAQRLIARSAQAIA
FT                   QLIADLRATLDIQCAVIGGSVGLAPDYLAQVQYFLRQLPHAYHTTLYPARHQRDAGLIG
FT                   AALWSRRETI"
     atgaatacgc tggccattga tctgggcgga accaagctgg cggcagcgtt ggtcgatgcc        60
     aacggccagc tgagccaacg cagcgaggtc gccacgccgg tcagcggtga cccggaggcc       120
     ctaacgaagg cgctctccca gctagtcacc cgctatcgag gaatggcagg cagggttgcc       180
     gtcgcctcta ccggcattat tcaccagggg atcctcagcg ccctgaatcc cgataacctg       240
     ggcgggctgg accgttttcc tctgcaggag tgcattgaga ggctcagcgc gctgccctgc       300
     tatcttctca acgatgccca ggccgcggcc tggtcagagt accttaccct gacccccagc       360
     ggtcaggata tggcgttcat tacggtatcg accggcgtcg gcggcggact ggtgctcaac       420
     ggtcgccttc agatcggacg cggtgccttc gctggccaca ttggccatac cctggccgat       480
     ccggcggggc cacgctgcgg ctgcgggcgc agcggctgcg tagagtccat cgcctcaggg       540
     cgggctatcg ccgcggcggc tcagggcgat ctgaccggcc tcgatgcccg cgctattttt       600
     cagcgggccg ccgctgacga tgcccaggca cagcgactca tcgcccgctc tgcgcaggcg       660
     atcgcccagc tgatcgccga tctgcgggcc acgctggata tccagtgcgc ggtgatcggt       720
     ggcagcgtcg gcctggcgcc agactatctg gctcaggttc agtattttct gcggcagctg       780
     ccgcacgctt accacaccac gctgtatcca gcccgccatc aacgcgatgc cggcctgatc       840
     ggtgcggcgc tctggagtcg gagagaaacg atatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page