(data stored in ACNUC7421 zone)

EMBL: CP001600.PE558

CP001600.PE558       Location/Qualifiers
FT   CDS_pept        complement(583757..584458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0600"
FT                   /product="disulfide bond formation protein, DsbB family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67829"
FT                   /db_xref="GOA:C5B755"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR023792"
FT                   /db_xref="UniProtKB/TrEMBL:C5B755"
FT                   /protein_id="ACR67829.1"
FT                   /translation="MSAKMWSDLRQNPVETLVRWQERRFLWLLMALAMGGLIVLAHAFF
FT                   QIYLYMAPCEQCVYIRFAMFVMVIGGLVAAINPRNLALKLFGCIAAFYGAIIGMGYSIK
FT                   LNGIHHAVHSPDALFGVQGCSTDPHFPFGLPLAEWSPSWFKPTGDCGYDAPMVPQGVAL
FT                   DSVQQWFIDMYVQAEGWYLIPSMQFMNMAQACFLAFALCFAILVIMSVAWAIHLLRRRA
FT                   VPADHTASTPR"
     atgtctgcaa agatgtggag tgacctgcgc caaaatccgg tcgaaacgct ggttcgctgg        60
     caggagcggc gctttctctg gctgctgatg gccctggcca tgggtgggct gatcgtcctg       120
     gcgcatgcct tttttcagat ctacctgtac atggccccct gcgaacagtg cgtctatatc       180
     cgctttgcta tgtttgtcat ggttatcggc ggactggtcg cggcgatcaa cccccgcaat       240
     ctggcgctga agctgttcgg ctgtatcgcc gccttctatg gcgccatcat cggcatgggg       300
     tactccatca aattgaacgg gatccatcat gcggtgcaca gcccggacgc gctgtttggc       360
     gtacagggat gctccaccga tccccacttt ccctttgggc tgcccctggc cgagtggtca       420
     ccctcttggt ttaagccgac cggcgactgc ggttatgatg cgccgatggt gccacagggg       480
     gtggcgctgg acagcgtaca gcagtggttt atcgacatgt acgtgcaggc ggagggctgg       540
     tatctgatcc cctccatgca gtttatgaat atggcgcagg cctgtttcct ggcctttgcg       600
     ctgtgctttg cgatcctggt gatcatgagc gtcgcctggg ctatccatct gctgcgccgc       660
     cgcgcggtgc ccgcagacca taccgcctct actccccgct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page