(data stored in ACNUC7421 zone)

EMBL: CP001600.PE559

CP001600.PE559       Location/Qualifiers
FT   CDS_pept        complement(584475..585146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0601"
FT                   /product="DsbA-like thioredoxin domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67830"
FT                   /db_xref="GOA:C5B756"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR028588"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5B756"
FT                   /protein_id="ACR67830.1"
FT                   /translation="MHLTLGKTHLKALLSATLLTCAFGAAAFSEGTDYVVLEKPIPNAQ
FT                   KTLIKVFSYDCPFCYKYDKAVTGPVSEKVKDVVRFEPYHLDTKGVYGPQGSEILAVLLN
FT                   KDRTAGVSIFDDASQFKKAKFAYYAAYHDKKERWKDGKDPAAFTQTGLDAAGLSHADLE
FT                   EGLKDPAVQNTLGEWKASAYDVAKIQGVPAYVVNGKYLLMTKSIKSVDSMADLVKELAA
FT                   K"
     atgcatttaa cgctgggtaa aacacacctt aaagccctgc tgagcgccac gctgctgacc        60
     tgcgccttcg gcgccgccgc ctttagcgaa ggcacagact acgtggtgct ggaaaaaccg       120
     atccccaacg cccagaagac cctaatcaaa gtcttcagct atgactgtcc cttctgctac       180
     aagtatgaca aggcagtcac cggccccgtc agcgaaaagg ttaaggatgt cgtacgcttc       240
     gagccgtacc acctggatac caaaggtgtc tatggaccac agggcagcga aattctcgcc       300
     gtgctgctca ataaggatcg caccgccggc gtctccatct tcgacgatgc ctctcagttc       360
     aaaaaggcca agtttgccta ctacgcggcc taccacgata aaaaagagcg ctggaaggat       420
     ggcaaggatc cggccgcctt tacccaaacc gggctggacg ccgccggcct gagccatgcc       480
     gatctggagg aggggctgaa ggatcccgcg gtgcaaaata ccctgggtga atggaaggcc       540
     tccgcctacg acgtagccaa gatccagggc gtaccggcct atgtggtcaa cggtaaatat       600
     ctgctcatga ccaagagtat caaatccgtc gactccatgg ccgatttagt caaagaactg       660
     gctgccaagt ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page