(data stored in ACNUC7421 zone)

EMBL: CP001600.PE564

CP001600.PE564       Location/Qualifiers
FT   CDS_pept        594948..595853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0606"
FT                   /product="radical SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67835"
FT                   /db_xref="GOA:C5B761"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C5B761"
FT                   /protein_id="ACR67835.1"
FT                   /translation="MQLQQLVNMFGADLQRRYGEKIHKLTLHGGFSCPNRDGTLGRGGC
FT                   TFCNVASFADEQMQRRSIAEQLEAQARKVNRARRYLAYFQAYTSTYAEVCILRDMYREA
FT                   LQQADMVGLCVGTRPDCVPESVLDLLAEYREQGYEVWLELGLQSASEKTLRRINRGHDF
FT                   ACYQRTTRAARARGLKVCSHLIVGLPGETQADCLSTLQRVVETGVEGIKLHPLHIVTGS
FT                   VLAKAWQAGRLQGLTLDRYVHTAGEMIRHTPPEVIYHRISASARRPTLLAPQWCENRWT
FT                   GMVAINNYLLEYGGQASALS"
     atgcagttgc agcaattggt caatatgttc ggcgccgacc tacagcgccg ctatggggaa        60
     aaaattcata agctcacgct gcacggtgga tttagctgcc ctaaccgcga tggaacgctg       120
     ggccgcggcg gctgtacgtt ttgcaacgtg gcctcctttg ccgatgaaca gatgcaacgg       180
     cgtagcatcg ccgaacagct ggaggcgcag gcgcgcaagg tcaaccgggc gcggcgctat       240
     ctggcctatt tccaggccta taccagcacc tatgccgagg tctgcatctt acgtgatatg       300
     tatcgggagg ctcttcagca ggccgatatg gtcggtctgt gcgtcggtac gcgtcctgac       360
     tgcgtaccgg agagcgtgct ggatttgctg gcagaatacc gtgagcaggg ttatgaggtg       420
     tggctggagc tcgggctgca gagcgccagt gagaagacgt tgcgccggat taaccgcgga       480
     catgatttcg cctgctatca gcgcacgacc cgcgccgccc gggcgcgtgg gctgaaggta       540
     tgcagtcacc tgatcgttgg gttgcccggt gagacgcagg cggactgtct cagtacgctg       600
     cagcgggtgg tggagaccgg cgtcgagggg atcaagctac atccgttgca tattgtgacc       660
     ggcagcgtac tggccaaggc ctggcaggcc ggacgcctgc aggggctgac attagatcgc       720
     tatgtccaca ccgccggaga gatgatccgc cacacgccgc cagaggtcat ctatcaccga       780
     atttctgcca gcgcccgccg ccccacgctg ctggcacccc agtggtgcga gaaccgttgg       840
     accgggatgg tcgctattaa taactatctg ctggagtacg gcggccaggc ttccgcgctg       900
     tcctag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page