(data stored in ACNUC7421 zone)

EMBL: CP001600.PE565

CP001600.PE565       Location/Qualifiers
FT   CDS_pept        596042..598378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0607"
FT                   /product="aerobic respiration control sensor protein ArcB,
FT                   putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67836"
FT                   /db_xref="GOA:C5B762"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:C5B762"
FT                   /protein_id="ACR67836.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSILLASALVLLAMVVQMAVTML
FT                   LRGQVDSIDVVRSVFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVNKLEEMRHRDLKL
FT                   NQQLKDNIRQLNQEIADRVKAEEARLQVLDTLQHEIDQRELAQVELEQQSALLRSFLDS
FT                   SPDLVYYRNENGEFSGCNRAMELLTGKSEKQLIGLTPRDVYDQDIAQKVIETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTELNEEQLKYLKTIHVSAIALGNIFNDIIE
FT                   MDKLERRKVQLDNQTIDFTGFLTDLENLSGLLVQPKGLSFTLAPDPALPHKVMVDGTRL
FT                   RQILWNLIGNAVKFTQRGGVSVRVWREQQDKLLFEVRDTGIGIPPEEQDKIFAMYYQVK
FT                   DMHGGKPATGTGIGLAVSKRLAQTMGGDIVVSSVAGEGACFTLSICAPVVEETLSEPLA
FT                   EEEMPLPALHVLLVEDIELNVIVARSVLEKMGNSVDVAMSGTEALAMFAPQEYDLVLLD
FT                   IQLPDMTGLDIARTLCRRYGKTALPPLVALTANVLKDKKEYLDAGMDDVLSKPLAVPAL
FT                   TAVIHRFWDSTPLTVLEDGEPHAHDLCELLDTEMLQQYLDLVGPQLIEQSLAVFERMMP
FT                   GYLSVLESNMTARDQKGITEEGHKIKGAAGSVGLRHLQQLAQQIQTPTLPAWWDNVQEW
FT                   IDELKQEWRHDVQILRDWVVQTNKK"
     atgaaacaaa ttcgggtatt ggcccagtat tacgttgatt taatggtaaa acttgggctg        60
     gtgcgcttct ccatcctatt ggcatcggcg ttggtgctgc tggctatggt ggtgcagatg       120
     gcggtgacca tgctactgcg tggtcaggtg gacagcattg acgtggtgcg ctcggtcttc       180
     tttggcctgc tgatcacgcc ctgggccgtc tattttctgt cggtggtggt ggagcagctg       240
     gaggagtcgc gccagcgcct gagtaagctg gtgaataagc tggaggagat gcgccatcgc       300
     gatctgaagc taaatcagca gctcaaggat aatatcagac agcttaacca agagattgcc       360
     gatcgcgtca aggccgaaga ggcccgcctg caagtgctgg ataccctgca gcatgagatc       420
     gatcagcgcg aactggcgca ggttgagttg gagcagcagt cggcgctgct gcgttcattc       480
     ctcgactcct ctccggatct ggtctactac cgtaatgaga atggtgagtt ttccggctgt       540
     aatcgggcga tggagctgct gaccggtaag agtgaaaagc agctgattgg actgacgcca       600
     cgcgatgtgt acgatcagga tattgcccag aaggtcatcg agaccgatga gaaggtcttc       660
     cgccataatg tttccctcac ctacgagcag tggttggtct atcccgacgg gcgtaaggcc       720
     tgctttgagc tgcgtaaggt acccttctat gatcgggtgg gtaagcgtca tggcctgatg       780
     ggttttggcc gtgatatcac ggagcgcaag cgttatcagg atgccctgga gaacgcaagt       840
     cgtgacaaaa ccacctttat ctcgaccata agccatgagc tgcgtacccc gctgaacggg       900
     atcgtcggcc tcagccgtat cctgctggat accgagctga atgaggagca gctgaaatac       960
     ctgaagacca ttcacgtcag cgcgatagcg ctggggaata ttttcaatga cattattgag      1020
     atggataaac ttgagcggcg caaggtgcag ctggataacc agactatcga ttttactggc      1080
     tttctgacag atctggagaa tttgtccggg ctattggtac agccgaaggg gttgagcttt      1140
     acgttggcgc cggatcccgc gctgccgcac aaggtgatgg tggatgggac gcgcctgcgc      1200
     cagatcctgt ggaacctgat cggtaatgcc gtcaagttca ctcaacgcgg cggcgtcagc      1260
     gttcgtgtct ggcgtgagca gcaggataaa ctgctgtttg aggtgcgcga taccggcatt      1320
     ggtattcctc cagaggagca ggataagatc tttgccatgt actatcaggt gaaagatatg      1380
     cacggcggta aaccggccac cggcaccggt attgggctgg ccgtctccaa gcgtctggct      1440
     cagaccatgg gcggcgatat tgtggtgagc agcgtagcag gagagggggc ctgctttacc      1500
     cttagcatct gtgcaccggt tgtcgaagag acgttaagcg agcctctcgc tgaagaggag      1560
     atgccgctgc cagcgctgca cgtcctgctg gttgaagata ttgagctgaa tgtgatcgtc      1620
     gcgcgctcgg tgctggagaa gatgggtaac agcgttgatg tggcaatgag cggcactgag      1680
     gcgctggcca tgtttgcgcc acaggagtat gacctggtgc tgctggatat ccagttgccg      1740
     gatatgaccg gcctggatat cgcccgcacg ctgtgccgac gttatggaaa aacggcgctg      1800
     ccgccgctgg tggcattgac tgctaatgta ttgaaggata agaaagagta tctggatgca      1860
     gggatggatg atgtgctgag caagccgctg gccgtaccgg cgttgacggc ggtgatccac      1920
     cgcttttggg acagtacccc gttgacggtg ctagaggatg gagagcctca tgcgcacgat      1980
     ctctgtgagc tgctggatac cgagatgctg cagcaatatc tggatctggt cggtccacag      2040
     ctgatcgagc agagcttggc ggtatttgag aggatgatgc caggctatct atcggtgctg      2100
     gaatccaata tgaccgcccg cgatcagaag gggatcaccg aagaggggca caagattaaa      2160
     ggtgccgcag gctctgtagg attgcgccat ttacagcagc tggctcagca gatccagacg      2220
     ccgacactgc cagcctggtg ggacaatgtg caggagtgga ttgacgaact gaaacaggag      2280
     tggcgccacg acgtgcagat tttacgcgac tgggtagtgc agactaataa aaaatga         2337
//

If you have problems or comments...

PBIL Back to PBIL home page