(data stored in ACNUC7421 zone)

EMBL: CP001600.PE566

CP001600.PE566       Location/Qualifiers
FT   CDS_pept        598755..599408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0609"
FT                   /product="DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67837"
FT                   /db_xref="GOA:C5B763"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5B763"
FT                   /protein_id="ACR67837.1"
FT                   /translation="MKRVGVVLSGCGVFDGSEIHEAVLTLLALSRIGAQAVCLAPDREQ
FT                   MQVIDHLHREPVAERRNVLVEAARIARGDVTSLAQADASQLDALIVPGGFGAAKNLSSF
FT                   ATDGAECSIDPALQRLVTSLHRDGKPLGFMCIAPALLPRLLGVPVRVTIGNDAATAAAI
FT                   EAMGGEHVACVVNDIVVDEVQRVVTTPAYMLANTIAEAAEGIDKLVTQVLDMTR"
     atgaaacgag tcggcgtagt actcagtggc tgcggggtat tcgatgggag tgagatccac        60
     gaggcggtat taacgctgct ggcactgtct cgaatcgggg cccaagcggt gtgcttggcg       120
     ccggatcggg agcagatgca ggtgatcgat catctacaca gagagccggt tgcggagcgg       180
     cgtaacgttt tggtggaggc ggcgcgtatt gcccgtggcg atgtgacatc gctggcgcag       240
     gcggatgcca gccagctgga tgcgctgatc gtacccggtg gattcggcgc ggctaaaaat       300
     ctcagtagct ttgcgacgga tggcgcggag tgcagcatcg atccggcgct gcagcgcctg       360
     gtcacgagtt tgcatcgcga cggaaagccg ttggggttca tgtgcattgc gccggcgctg       420
     ctgcccaggc tgctgggcgt tccggtgcgg gtaaccatcg gtaatgatgc tgccactgcc       480
     gccgcgattg aggcaatggg cggggagcac gtggcctgtg tagtgaatga tattgtggta       540
     gacgaggtgc agcgggtcgt gacgacgccg gcctatatgc tggccaatac gatcgccgag       600
     gcagcggagg ggatcgataa gctggtcaca caggttctgg atatgacccg atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page