(data stored in ACNUC7421 zone)

EMBL: CP001600.PE570

CP001600.PE570       Location/Qualifiers
FT   CDS_pept        complement(601427..601813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0613"
FT                   /product="conserved hypothetical protein TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67841"
FT                   /db_xref="GOA:C5B767"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C5B767"
FT                   /protein_id="ACR67841.1"
FT                   /translation="MAAVPERQHRSGSVTAHQIGAYHEQRARRYLERAGLRFYAANVRL
FT                   RGGEIDLIMRDGATWVFVEVRYRKTACYGDAAASIDSRKRQRLQRCAAHWLAVRNQSIE
FT                   TADCRFDVLAITGSQLQWLPNAFV"
     gtggctgcag taccagaaag gcagcatcgt tccggttctg taaccgctca ccagatcggc        60
     gcgtaccatg aacaacgggc gcgccgctat ctggagcggg ccgggctgcg tttttacgcc       120
     gccaacgtac gtctacgcgg cggtgagatc gatctgatta tgcgcgatgg tgccacctgg       180
     gtctttgtcg aggtgcgcta ccggaaaaca gcctgctacg gcgacgcagc cgccagcatt       240
     gatagccgta agcgtcagcg tctacagcgc tgcgcggcac actggttggc ggtgcgaaat       300
     cagagcatag aaacggccga ttgtcgtttt gacgttttgg caatcaccgg cagccagtta       360
     caatggctgc ccaatgcatt tgtctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page