(data stored in ACNUC7421 zone)

EMBL: CP001600.PE572

CP001600.PE572       Location/Qualifiers
FT   CDS_pept        603880..604749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0615"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67843"
FT                   /db_xref="GOA:C5B769"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C5B769"
FT                   /protein_id="ACR67843.1"
FT                   /translation="MNQNDHAAISAATLYVVPTPIGNLGDITQRALETLKAVDLIAAED
FT                   TRHTGMLLQHFAINARFFALHDHNEQQKADQLLAKLREGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALSAAGVASDRFCYEGFLPAKGKARRDRLRGLQQEA
FT                   RTLIFYESTHRLLESLADMVSELGTDRYVVLARELTKTWESIHGAPVAELLAWVQQDEN
FT                   RRKGEMVLIVEGYQADEEVLSPEALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYA
FT                   LAQQSGDK"
     atgaatcaaa acgatcatgc tgccatttct gcggcgacgc tgtacgtggt gccgacgccg        60
     attggtaacc tcggagacat tacccagcgg gcgttggaga cgctgaaagc ggtcgatttg       120
     atagcggcgg aagatacccg tcatacggga atgctgctac aacattttgc cataaatgcg       180
     cgcttctttg cattgcatga ccataacgag caacaaaaag cggatcagct actggctaaa       240
     ctgcgcgagg ggcagagtat tgcgctggtc tctgatgccg gtacgccgct gattaacgat       300
     cccggctatc acttggtgcg ccgctgtcgc gaggccggta tccgggtggt gccgctgccg       360
     ggcgcctgtg cggcgatcac cgcactgagt gcggcgggtg tggcgtcaga tcgcttctgc       420
     tacgagggtt ttttacccgc caagggaaaa gcgcggcgcg atcggctgcg tggcctgcag       480
     caggaggccc gtacgctgat cttctacgag tcgacccatc gcctgctgga gagtttggcg       540
     gatatggtca gtgaactggg taccgatcgc tatgtggtgt tggcacgcga attgaccaaa       600
     acctgggaga gtattcatgg cgcgccggtg gctgagctgc tggcctgggt gcagcaggat       660
     gagaatcggc gtaagggcga gatggtgctg atcgtcgagg gataccaggc ggatgaagag       720
     gtgctgtcgc ccgaggcgct gcgtacgctg gcgctgctac aggcagagct accgctgaaa       780
     aaggcggcag cgctggcggc agaaatccat ggcgtgaaga agaatgcgct gtataaatac       840
     gcactcgcgc agcaatcagg tgacaagtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page