(data stored in ACNUC7421 zone)

EMBL: CP001600.PE573

CP001600.PE573       Location/Qualifiers
FT   CDS_pept        complement(605188..605868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0617"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67844"
FT                   /db_xref="GOA:C5B770"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:C5B770"
FT                   /protein_id="ACR67844.1"
FT                   /translation="MVKATLRFRLHRTAIVLICLALLVTLMQGASYFSLSHQRARLDQV
FT                   GELAQTLAQQVAARLSPLINDDTPDTKKIAPILDALTRHSRILDVSVYALDGALIAQAG
FT                   ERVEVRDRLALDGQRAGSYFNHQIVQPIEGRDGPLGFLRLTLDTHVLATESQQVDNTTN
FT                   LLRLMMLLALAIGIILARTLLQTRRSRWQQSSYLLTANVPLEEENERDASVQENTAPTT
FT                   PPKS"
     atggttaagg caacgcttcg cttccgcctg catagaacag ccatcgtgct gatatgcttg        60
     gcattattag ttaccctgat gcaaggagcg tcctatttta gcctcagtca ccagcgcgcg       120
     cggctcgatc aggtcggcga gctggcgcaa accctggctc agcaggtcgc cgcccgcctc       180
     tccccactca tcaatgacga taccccggac accaaaaaaa ttgcccccat tctggacgcg       240
     ctgacccgcc acagccgtat cctggatgtc agcgtctatg ctctggatgg ggcgctgatt       300
     gcccaggctg gcgaacgggt ggaagtgcgc gatcggctgg cgctggacgg acagcgcgcc       360
     ggtagctact ttaaccacca gatagtccag ccgatcgagg gccgcgatgg ccccctcggc       420
     tttttacgtc tgacgctgga cacccacgtt ttggcgaccg aatcacagca ggttgacaac       480
     accactaacc tgctgcgcct gatgatgctg ctggcgctgg ctattggcat cattttagca       540
     cgcacgctgc tgcagacacg gcgcagccgc tggcaacaat cctcctatct gctgactgcc       600
     aatgttccgt tggaggagga gaatgaacgc gatgcgtcgg tgcaggagaa taccgcaccg       660
     accacgccgc caaagtccta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page