(data stored in ACNUC7421 zone)

EMBL: CP001600.PE575

CP001600.PE575       Location/Qualifiers
FT   CDS_pept        607008..608396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0619"
FT                   /product="DNA repair protein RadA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67846"
FT                   /db_xref="GOA:C5B772"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C5B772"
FT                   /protein_id="ACR67846.1"
FT                   /translation="MAKAVKRAFVCNECGADYPRWQGQCSACQAWNSISEVRLAAAPAA
FT                   GRSARLSGYAGDAGSLSKVQKLSEISLEALPRFSTGFTEFDRVLGGGVVPGSAILIGGN
FT                   PGAGKSTLLLQTLCRLSQQMKTLYVTGEESLQQVAMRAHRLGLPTEGLNMLSETSIEQI
FT                   CLIAEQEQPKLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHV
FT                   TKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREV
FT                   SNPSAIFLSRGEEITAGSSVMVVWEGTRPLLVEIQALVDTSMMSNPRRVAVGLEQNRLA
FT                   ILLAVLHRHGGLQMADQDVFVNVVGGVKVSETSADLALLMSLVSSLRDRPLPQDLVIFG
FT                   EVGLAGEVRPVASGQERIIEAAKHGFRRAIVPYANVPKKAIPNMTVYGVKKLSDALDIL
FT                   QDLA"
     gtggcaaagg cggtaaaacg ggcgtttgtc tgtaatgagt gcggggcgga ctatcctcgc        60
     tggcaggggc agtgctcggc ctgtcaggcc tggaatagca tcagcgaggt acgcctggcg       120
     gcggcgccgg cggcggggcg aagcgcgcgt ctgtctggct atgccgggga tgccggaagc       180
     ctgagcaagg tacagaagct gtcggagata agcctggagg cgctaccgcg tttttcgacc       240
     ggttttaccg agtttgaccg ggtgctgggc ggcggcgtgg tgcccggcag cgccattttg       300
     atcggcggaa atcccggcgc aggcaagagt accctgctgc tgcagaccct gtgccgactg       360
     tcacagcaga tgaagaccct gtatgtgacc ggtgaggagt cgctgcagca ggtggcgatg       420
     cgcgcccatc gcctcggcct gccgacggag ggcctgaata tgctgtcgga gaccagcatc       480
     gagcagattt gcctgatcgc cgagcaggaa cagccgaagc tgatggtgat cgattctatc       540
     caggtgatgc atatggccga tattcagtct tcgcccggca gcgtggcgca ggtgcgtgaa       600
     acggcggcct atctgacgcg ctttgccaag acgcgcggcg tagcgatcgt tatggtcggc       660
     cacgtcacca aggatggctc tctggccggt cccaaggtgc tggagcactg catcgactgc       720
     tctgtgctgc tcgacggcga cgccgactcg cgttttcgta ccctgcgcag ccataaaaac       780
     cgcttcggtg cggtcaatga gctgggggtc ttcgccatga ccgagcaggg actgcgcgag       840
     gtcagcaacc cgtcggccat cttcctcagc cgcggtgagg agatcactgc cggcagttcg       900
     gtgatggtgg tgtgggaggg gacccgcccg ctgctggtgg agatccaggc gctggtggat       960
     acctccatga tgtccaatcc gcggcgggtt gccgtggggc tggagcaaaa ccgtctggcg      1020
     attctgctgg cggtgctgca tcgccacggt gggctgcaga tggccgatca ggatgtcttt      1080
     gtcaacgtgg tcggcggggt aaaggtaagc gagaccagcg cggatctggc gctgctgatg      1140
     tcgctggtgt ccagtctacg cgaccggccg ctaccgcagg atctggtgat ctttggcgag      1200
     gtgggactgg cgggcgaggt gcgtccggtt gccagcggtc aggagcgcat tattgaggcg      1260
     gccaagcacg gcttccggcg ggcgatagtc ccctatgcca atgtgccgaa gaaggcgatc      1320
     ccaaatatga cggtttacgg cgtgaagaag ctgtctgacg cactggatat tctgcaggat      1380
     ctggcatga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page