(data stored in ACNUC7421 zone)

EMBL: CP001600.PE576

CP001600.PE576       Location/Qualifiers
FT   CDS_pept        complement(608459..610126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0620"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67847"
FT                   /db_xref="GOA:C5B773"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C5B773"
FT                   /protein_id="ACR67847.1"
FT                   /translation="MAQYVYTMNRVGKIVPPKRHILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDTDIEGEARPQPGIKIGYLPQEPKLNLEQTVREAVEEAVGEVKQALTRL
FT                   DEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPAWDAKIANL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAK
FT                   GRQSKGKARLARFEELNNTDYQKRNETSELFIPPGPRLGDKVLEVSNLSKSYGDRLLID
FT                   ALSFSIPKGAIVGIIGPNGAGKSTLFRMISGQEQPDSGSITLGDTVTLASVDQFRDAMD
FT                   DKKSVWEEVSGGQDIMRIGNFEIASRAYVGRFNFKGTDQGKRVGELSGGERGRLHLAKL
FT                   LQVGGNMLLLDEPTNDLDVETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDE
FT                   GRVEFFEGNFSEYEEYKKRTQGAEALQPHRIKYKKIAK"
     gtggctcaat acgtctatac catgaaccgc gtcggcaaaa tcgtcccgcc gaagcgtcac        60
     atcctgaaag atatttccct cagtttcttc ccgggtgcca aaatcggcgt gctgggttta       120
     aacggcgcgg ggaaatccac cctgctgcgc attatggccg gcgttgatac cgatatcgaa       180
     ggcgaggcac gtccgcagcc agggattaag atcggctacc tgccgcagga gccgaagctc       240
     aatctggagc agactgtccg cgaggcggtg gaagaggccg tgggcgaggt taagcaggcg       300
     ctgacccgtc tggatgaggt gtacgccctg tacgccgatc cggacgccga ctttgacaag       360
     ctggccaaag agcagggaga actggaggcg atcatccagt cccacgatgg ccacaatctg       420
     gataaccagc tggagcgcgc cgccgatgcg ctgcgcctgc cagcctggga tgccaagatc       480
     gccaatctct ccggcggtga gcgtcgccgt gtggctatct gtcgtctgct gctggaaaaa       540
     ccggatatgc tgctgctcga cgagccaacc aaccacctgg acgccgaatc cgtcgcctgg       600
     ctggagcgct tcctccacga ctatgagggc accgtcgtcg ccatcaccca cgaccgctac       660
     ttcctggaca acgtcgccgg ctggatcctc gagctggacc gcggcgaggg gatcccgtgg       720
     gagggtaact actcctcctg gcttgagcaa aaggatcagc gcctggcgca ggaggcctct       780
     gctgaagccg cccgccgtaa atccattgag aaagagctgg agtgggtgcg tcagggcgcc       840
     aaggggcgtc agtcgaaggg caaggcccgc ctggcccgct ttgaagagct caataatacc       900
     gattaccaaa agcgtaacga gaccagcgag ctgttcattc cgccgggacc gcgcctgggc       960
     gacaaagtgc tggaggtcag caacctatcc aaatcctacg gcgatcgcct gctgatcgat      1020
     gcgctctcat tcagcatccc gaaaggggct atcgtcggca tcatcggccc gaacggcgcc      1080
     ggtaagtcca ccctgttccg catgatctcc ggccaggagc agccggacag cggtagcatc      1140
     acgctgggcg acaccgtgac cctggcctcc gtcgaccagt tccgcgatgc catggacgat      1200
     aagaaaagcg tctgggaaga ggtctccggc gggcaggaca tcatgcgtat cggtaacttt      1260
     gagatcgcca gccgcgccta tgtcggccgc ttcaacttta aaggcaccga tcagggcaaa      1320
     cgcgtcggcg agctctccgg cggggagcgt ggccgtctgc atctggccaa gctgctgcag      1380
     gtcggtggca atatgctact gctcgacgaa ccgaccaacg atctggacgt tgaaaccctg      1440
     cgcgcactgg agaacgccct gctggagttc ccgggctgcg ccatggtcat ctcccatgac      1500
     cgctggttcc tcgaccgtat cgcgacccat atactcgact atcaggatga gggacgcgtc      1560
     gaattcttcg aggggaactt cagcgagtac gaagagtaca agaagcgcac ccagggcgcc      1620
     gaagccctgc agccgcaccg tatcaaatac aagaagatcg ccaaataa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page