(data stored in ACNUC7421 zone)

EMBL: CP001600.PE577

CP001600.PE577       Location/Qualifiers
FT   CDS_pept        610507..612435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0621"
FT                   /product="transglycosylase SLT domain protein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67848"
FT                   /db_xref="GOA:C5B774"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:C5B774"
FT                   /protein_id="ACR67848.1"
FT                   /translation="MVMVGKWRYWSVGLCLALSAAAASADSLDAQRARYQQIKQAWDAN
FT                   RMDSVNQLMPTLRDYPLYPYLAYRALTQDMSQVNAQQIKAFLQQYPTLPPARSLTSRYV
FT                   NELARREDWIGLLVFSPQLPQPVAARCNYYYAQYATGHAEVAWRGAQTVWMSGQSLPSS
FT                   CDKLFDAWRGAGGLRDQAVLARLRLALEKGNAGLVKYLQQQLPENYRTLNTALTALQAN
FT                   PRSVEAFARSVAPSDFTRDIVGGAFASLARQDADAARAMLPTLVRLQHIPPDKRQEMEE
FT                   IIAWRLMGSDASADDRRWRDGVIRRSHNAALLERRLRMALGEGNQVQVREWLGRLPKSV
FT                   HDKDEWRYWHAVALIDEGKRSEGQAILRALIKQRGFYPMVAAQRLGIPYPLQVMRAARP
FT                   DAALTQEPAIARVRELMYWNMDNTARSEWRALVASKPRPQQEALARYALEQGWADLSVQ
FT                   ATIVAKLWDHLQERFPLAWPQEFRSATEDKGITQSYAMAIARQESAWNPGARSSVGASG
FT                   LMQLMPKTAEHTAKMFSLSHYQNSSQLFDPKTNIDIGTRYLEYVYQSLGRNRILASAAY
FT                   NAGPSRVNSWLGNSAGQIDAVAFIESIPFSETRGYVKNVLAYDAYYRYFMHRPEQILTD
FT                   AEWARRY"
     atggtcatgg tgggcaaatg gcgctattgg agcgtcgggc tgtgcctggc gctgagcgcg        60
     gcggcggcct cggcagattc gctcgatgcg cagcgcgcgc gctatcaaca gattaagcag       120
     gcgtgggacg ccaaccggat ggacagcgtc aatcagctga tgccgacgct gcgtgactat       180
     ccgctgtacc cctatctggc ctatcgggcg ctgacgcagg atatgtccca ggttaacgcg       240
     cagcagatta aggccttttt gcagcagtat ccgacgctgc cgccggcgcg cagcctgacg       300
     tcgcgctatg tcaatgagct ggcgcggcgc gaggactgga taggcctgct cgtcttcagt       360
     ccccagctgc cgcagccagt ggcggcgcgt tgtaactatt attacgctca gtatgccacg       420
     gggcatgcgg aggtggcgtg gcgtggcgcg cagacggtct ggatgagcgg tcagtcactg       480
     ccctccagct gtgacaaatt gttcgatgcc tggagggggg ctggtgggct acgggatcag       540
     gcggttctgg cccgcctgcg tctggcgctg gagaagggca acgcagggct ggtgaaatac       600
     ctgcagcagc agctaccgga gaactaccgg actctgaata ccgcgctgac ggcgctgcag       660
     gccaatccgc gcagcgtaga ggcatttgcc cgcagcgtcg caccgagcga ttttacccgt       720
     gatatcgtgg ggggtgcctt tgcctcgctg gcgcgtcagg atgcggatgc cgcgcgggca       780
     atgctgccta cgctggtgcg tttacagcac attccgccgg acaaacggca ggagatggaa       840
     gagatcattg cctggcgcct gatgggcagc gatgccagcg ccgacgatcg ccgctggcgc       900
     gatggcgtga tccgtcgcag ccataatgcg gcgttgctgg agcgacgtct gcgtatggcg       960
     ctgggggagg gcaatcaggt acaggtgcgc gaatggttgg ggcgtttacc gaagtcagtg      1020
     catgataagg atgagtggcg ctattggcat gcagtggcat tgatagatga gggtaaacgc      1080
     agcgaggggc aggcgattct gcgggcgctg atcaagcagc gcggctttta tcctatggtg      1140
     gccgcccagc ggctgggtat tccctatccg ctgcaggtga tgcgggcggc acgcccggat      1200
     gccgccctga cgcaggagcc tgcgatcgcc cgggtgcgcg agttgatgta ctggaatatg      1260
     gataataccg cgcgcagtga gtggcgcgcg ctggtcgcca gcaagccccg ccctcaacag      1320
     gaggcgttgg cacgctatgc cctggagcag gggtgggccg atttgagcgt gcaggcgacg      1380
     attgtggcta agctatggga tcatctgcag gaacgattcc cgctggcctg gccgcaggag      1440
     ttccgcagtg caacggaaga taaagggatc acccaaagct atgccatggc gattgcccgc      1500
     caggagagtg cctggaaccc gggggcccgc tcatcggtcg gcgccagcgg cctgatgcag      1560
     ctgatgccaa agacggctga gcacacggcc aagatgttca gcctgagtca ctatcagaac      1620
     agcagtcagc tgttcgatcc caaaaccaat atcgatattg gtacccgtta tctggagtac      1680
     gtctaccaga gtctgggacg taaccgtatt ctggcgagcg cagcgtacaa cgcagggccg      1740
     tcacgggtga attcctggct cggcaacagc gctgggcaga tagatgcggt ggcgtttatc      1800
     gagagcattc cgttctcgga gacgcgtggc tatgtgaaga acgtcttagc ctatgatgcc      1860
     tactatcgct atttcatgca tcgaccggag cagatactga cggatgctga atgggcgcgc      1920
     cgctactag                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page