(data stored in ACNUC7421 zone)

EMBL: CP001600.PE579

CP001600.PE579       Location/Qualifiers
FT   CDS_pept        complement(612847..613383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0622"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67849"
FT                   /db_xref="GOA:C5B776"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5B776"
FT                   /protein_id="ACR67849.1"
FT                   /translation="MYHVVAATTNPAKIQAITLAFDATFGAGQYRIEGIDVDSGVPEQP
FT                   LGSIQTRSGARHRVICARQLRPEADFWVGIEAGIEDNMTFAWMSVENRCHRGESRSASL
FT                   TLPDRVMDGIRQGQTLGYEMRRLSGIDDINRREGAIGIFTQGRLSRTSVYYQALLLALA
FT                   ALEPGYHHKPPPHYA"
     atgtaccatg ttgtcgccgc gaccaccaat ccggctaaaa ttcaagccat tacactggca        60
     tttgacgcta cctttggcgc cggacaatac cgcattgaag ggatagacgt cgacagcggc       120
     gtgccagagc agcccctggg cagcatccag acgcgcagcg gggcgcgtca ccgcgttatc       180
     tgcgcccgtc aactgcggcc agaagcagac ttttgggtcg gcattgaggc gggaattgaa       240
     gataatatga cctttgcctg gatgtcggta gaaaaccgct gccaccgcgg cgaatcccgc       300
     tccgccagcc tgacgctgcc ggaccgcgtc atggacggta tccgacaggg gcagacgctg       360
     gggtatgaaa tgcgccgcct gagcggcatt gatgatatta accgtcggga gggcgccatc       420
     ggcatcttta cccagggacg gctcagccgc accagcgtgt attaccaggc gctgctgtta       480
     gccctggcgg cgctggagcc aggctatcac cacaagccgc caccccacta cgcctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page