(data stored in ACNUC7421 zone)

EMBL: CP001600.PE58

CP001600.PE58        Location/Qualifiers
FT   CDS_pept        complement(51811..52587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0060"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67320"
FT                   /db_xref="GOA:C5B9E0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9E0"
FT                   /protein_id="ACR67320.1"
FT                   /translation="MPARLSVVLICKNAAELLPECLASVAWADEIIVLDSGSSDETQRI
FT                   AQAAGAKVYENHDWQGFGIQRQRAQQYASGDYILMIDSDERVTPALKEAIVQVLTQPVA
FT                   DRVYSIARRNLFLGRFMRHSGWYPDRVIRLYPRQRYGYNASQVHESLACSGASVTPLQG
FT                   DLLHLTCRDFAGFQQKQLCYATAWAHERHASGKKTSILGIFSHTVGALLKTLLLRGGVL
FT                   DGKQGWLLAIVNAQYTFNKYAELWALQHGYTEKTPL"
     atgccagcgc gcctctccgt cgtcctgatt tgcaagaatg cggctgaact cctgccggag        60
     tgtctggcct ccgtggcatg ggccgatgaa atcatcgttc tggactccgg cagcagtgat       120
     gagacgcagc gtatcgccca agccgccggc gccaaggtct atgaaaacca cgactggcaa       180
     ggattcggca tccagcgcca gcgggcacag cagtatgcca gcggtgacta tattctgatg       240
     atcgacagcg atgagcgcgt cacaccggcg ctgaaagagg ccattgttca ggttctcacg       300
     caacctgtcg ccgatcgggt atacagcatc gcccgccgca atctgttttt ggggcgcttt       360
     atgcgtcaca gtggctggta tcccgaccgg gtgatccgcc tctacccgcg ccagcgctac       420
     ggctataacg ccagccaggt ccatgaatcc ctggcgtgca gtggcgcatc agtcacgcca       480
     ctgcagggcg atctgctgca cctgacctgc cgtgattttg ccggattcca gcaaaaacag       540
     ctgtgctatg ccacggcctg ggcgcatgag cgccacgcca gcggtaaaaa gacatccata       600
     ctgggcatat tcagccatac cgtcggcgcc ctgctaaaaa ccctgctgct gcgcggcggg       660
     gtgttggacg ggaaacaggg atggctgctg gccatcgtca acgcacagta cacatttaac       720
     aaatacgccg agctgtgggc actgcagcat ggctatacgg aaaaaacgcc tttatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page