(data stored in ACNUC7421 zone)

EMBL: CP001600.PE582

CP001600.PE582       Location/Qualifiers
FT   CDS_pept        615280..615768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0626"
FT                   /product="CreA protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67853"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:C5B779"
FT                   /protein_id="ACR67853.1"
FT                   /translation="MNKYFVGLCVALTTLLGSSVHAEEIGSVDTVFKLLGPDHKIVVEA
FT                   FDDPDVENVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIALSEKIRNKKADGEV
FT                   VFRKRTSLIFKKLQVVRFYDSKRNVLIYLSYSDRVVEGSPKNAISAVPVMPWSAAPQG"
     gtgaataaat attttgttgg tttatgtgtc gcgttgacga ccctgttggg atcctcggtc        60
     cacgccgagg agatcggctc tgtcgacacg gtatttaagc tgcttggacc agatcataag       120
     attgtggttg aggcctttga cgatcctgac gtggaaaatg tgacctgtta cgtcagccgg       180
     gcgaaaaccg gagggattaa aggtggtttg ggattggctg aggatacttc tgatgcggcg       240
     atctcatgtc agcaggtggg gccgatcgcg ctgagtgaaa aaattcgtaa caaaaaagcg       300
     gatggcgagg tggtatttcg taaacgcaca tcgctgatat ttaagaagct acaggtcgtg       360
     cgcttttatg acagcaagcg caatgtgctg atctatctct cctattctga tcgggtcgtg       420
     gaaggatcgc cgaagaacgc aatcagtgcg gtgccagtga tgccgtggag cgcagcaccg       480
     caggggtaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page