(data stored in ACNUC7421 zone)

EMBL: CP001600.PE584

CP001600.PE584       Location/Qualifiers
FT   CDS_pept        complement(617674..618378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0628"
FT                   /product="conserved hypothetical protein TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67855"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:C5B781"
FT                   /protein_id="ACR67855.1"
FT                   /translation="MTQLQFEPIGVIRSPYKEKFAIPRQPGLICDGGGTLDLLPPYNQP
FT                   EAVRGLEGFSHLWVIFVFHQTMDGGWRPTVRPPRLGGNARVGVFATRSTFRPNPIGMSL
FT                   VELHGIETRNGVRLQLGSLDLVDGTPVLDIKPYLPFAESQPQARAGFAQQAPPANMPVL
FT                   FSPGAQAQIAQRQQDYPHLTRFIRQILAQDPRPAYRRVEEENRVYAVHLLDFNLRWQVK
FT                   NDVCEVLGLDPR"
     atgacccaac tccaatttga accgataggc gtcattcgct cgccctataa agaaaaattc        60
     gccattccgc gccagccggg gctgatctgc gacggcggcg gaacgctgga cttattaccc       120
     ccctataacc agccggaggc cgtacgtgga ctagaggggt ttagccatct gtgggtcatt       180
     tttgtcttcc accaaaccat ggacggtggc tggagaccca cggtgcgtcc gccgcgcctc       240
     ggcggtaacg cgcgcgtggg cgttttcgcc acccgttcca ccttccgccc caacccgatc       300
     ggaatgtctc tggttgaact gcacggcatt gagacacgca acggtgtgcg gctccagctc       360
     ggcagcctgg atctggtaga cgggactccg gtgctggaca ttaagcccta cctgcccttt       420
     gccgagagcc aaccgcaggc gcgcgcaggg tttgcacagc aggcgccgcc ggctaatatg       480
     cccgttctct tcagccccgg agcacaggcg caaatcgccc agcggcagca ggactatccg       540
     cacctgacgc gctttatccg ccagattctg gcgcaggatc cccgtccagc ctaccgccgc       600
     gtagaagagg aaaatcgggt ttacgcggta cacctgctgg atttcaacct acgctggcag       660
     gtaaaaaacg acgtctgcga agtgctggga ctcgatccgc gctag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page