(data stored in ACNUC7421 zone)

EMBL: CP001600.PE585

CP001600.PE585       Location/Qualifiers
FT   CDS_pept        complement(618375..618797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0629"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67856"
FT                   /db_xref="GOA:C5B782"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:C5B782"
FT                   /protein_id="ACR67856.1"
FT                   /translation="MRALPLCLLTASLALSGCSLLSRQATLIKPLAADKTPETVAKPRA
FT                   VTPRQTPITLYESAEDLIGKPFRDLGEVSGSVCQTRTHHRAPSLTTARKRMLYKAAQLK
FT                   ANAVLLHSCQILSQSNGCYRQAICTGSALSIAMSAQ"
     atgcgtgcat taccgttatg cctgcttacg gccagtcttg cgctgagcgg ctgctctctg        60
     ctgtcacgcc aggctaccct gatcaagcca ctggctgcag acaaaacgcc ggaaaccgtc       120
     gccaagccac gcgccgttac gccgcgtcag acgccgatta cgctatatga gagcgctgag       180
     gatctgattg gcaaaccctt tcgcgatctc ggcgaagtca gcggcagcgt ttgtcagacc       240
     cgcactcacc atcgcgctcc cagcctgact accgcgcgta agcgtatgct atataaggcc       300
     gctcagctaa aggcaaacgc tgtgctgctg cacagctgcc agatccttag ccagagcaat       360
     ggctgctatc gccaagccat ctgtaccggc tccgccctta gcatcgcaat gtcagcccaa       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page