(data stored in ACNUC7421 zone)

EMBL: CP001600.PE587

CP001600.PE587       Location/Qualifiers
FT   CDS_pept        complement(619786..620439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0631"
FT                   /product="D-methionine transport system permease protein
FT                   MetI, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67858"
FT                   /db_xref="GOA:C5B784"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B784"
FT                   /protein_id="ACR67858.2"
FT                   /translation="MSEAMMWLMVRGIWETVVMTLVSGFFGFVIGLPIGVLLYTSRPGQ
FT                   ILENAQLYKLLSALVNIFRSIPFIILLVWMIPFTRLIVGTSIGLQAALVPLTIGAAPFI
FT                   ARMVENSLLEIPSGLIEAARAMGATPMQIINKILLPEALPGLINAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFSGDRIVKAISRK"
     atgtctgagg caatgatgtg gttaatggtc cgcggcatct gggaaactgt cgttatgacc        60
     ctggtctccg gtttctttgg ctttgtcatc ggactaccga tcggcgtact gctgtacacc       120
     tcgcgtccgg gacaaattct ggaaaatgcg cagctgtata agctgctgtc cgcgctggtg       180
     aatatctttc gctccatccc gtttatcatc ctgctggtct ggatgatccc gtttacccgc       240
     ctaatcgttg gcacctctat cggtctgcag gcggcgctgg ttcccctgac catcggcgcg       300
     gcgcccttca tcgctcggat ggtggaaaac agcctgctgg agatcccaag cggcctgatt       360
     gaagcggcgc gggcaatggg tgcgaccccg atgcagatca tcaataagat cctgctgccg       420
     gaggcgttgc cggggctgat taacgcggcg accattacgc tgatcaccct ggtaggctac       480
     tcggcgatgg gtggggcggt tggtgccggt ggactcggac aaatcggcta tcaatacggt       540
     tatatcggtt acaacgcaac ggtaatgaat acggtattag tattgctggt cgttttagtg       600
     tatttgatcc agttcagcgg tgaccgcatc gtcaaggcga tcagccgtaa ataa             654
//

If you have problems or comments...

PBIL Back to PBIL home page