(data stored in ACNUC7421 zone)

EMBL: CP001600.PE588

CP001600.PE588       Location/Qualifiers
FT   CDS_pept        complement(620432..621394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0632"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67859"
FT                   /db_xref="GOA:C5B785"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C5B785"
FT                   /protein_id="ACR67859.1"
FT                   /translation="MSLHVPAGQIYGVIGSSGAGKSTLIRCVNLLERPTQGQVFVDGQD
FT                   LTAMSAGQLTRTRRQIGMIFQHFNLLSSRTVYGNIALPLELDRVPRDEITRRVTELLAL
FT                   VGLADKRDAYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRAILELLKDI
FT                   NRRLGLTILLITHEMDVVKRICDQVAVISQGKLIEQGSVGEVFSHPKTPLAQQFIHATL
FT                   HLDIPDDFAARMTPTRGADSQPLLRLEFTGQSVDAPLISQAVRRFNVDINILSSQMDYA
FT                   GGVKFGVMLAEVHGDDTDAQAAIAFFEQHHVKVEVLGYV"
     gtgtcgctgc acgtacccgc cggacagatt tacggcgtca tcggttcatc cggcgcgggt        60
     aaaagcaccc tgatccgctg cgtcaattta cttgaacgcc caacgcaggg acaggtattc       120
     gtcgacggcc aggatctgac ggcgatgagc gccgggcagc taacgcgcac gcgccgccaa       180
     atcggcatga ttttccagca cttcaatttg ctctcctcgc ggacggtcta tggcaacatc       240
     gccctgccgc tggagctgga tcgcgtgccg cgcgacgaga tcacgcgccg ggttaccgaa       300
     ttattggcat tggtcggtct agcagacaag cgcgatgctt accccgccaa cctctccggt       360
     ggacagaaac agcgcgtagc tatcgcccgc gcgttggcca gtaaccccaa agtgctgctg       420
     tgcgacgaag ccaccagtgc gctggatccg gccaccaccc gcgcgattct ggagctgttg       480
     aaagatatca accgccgtct gggactgacc attctgctga tcactcatga gatggacgta       540
     gtcaagcgta tctgcgatca ggttgccgtc atcagtcagg gaaagctgat cgaacagggc       600
     agtgtcggcg aggtgttttc tcatcccaag acaccgctgg cccaacagtt tatccacgcc       660
     acgctacatc tggatatccc ggatgacttc gctgcacgta tgacacccac ccgcggtgcc       720
     gatagccagc cgctgttacg cctggagttt accggccagt cggtcgatgc accgctgatt       780
     tctcaggcgg tgcgacgttt caatgtcgac atcaacattc tcagctccca aatggattat       840
     gccggcggag tgaagtttgg cgttatgttg gccgaagtcc acggcgacga taccgatgcc       900
     caggccgcca tcgccttttt tgaacagcat cacgtgaaag ttgaggtact gggttatgtc       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page