(data stored in ACNUC7421 zone)

EMBL: CP001600.PE592

CP001600.PE592       Location/Qualifiers
FT   CDS_pept        complement(629579..630895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0641"
FT                   /product="Pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67864"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C5B790"
FT                   /protein_id="ACR67864.1"
FT                   /translation="MLPLPHSGLFSRNLSRNDISLVKNATDIGHIGSRFNRIVNKVLDW
FT                   CCNTKKTEAMEQLFIVMNQDHNQSNKARCEAFDQLQELVGSAHSDRFTKKYDVVDNCIK
FT                   FNIDIDGEENFITLTKDDFFEGLNLSGADLTDISLQNGKLGYVDLSGAKLDHANLTGAQ
FT                   LSFANLSGATLDHADLTGAQLSFAKLSGASLNNATLNQADMDNADLSNATLNQAVLKNV
FT                   NLSSAILRQAKLNDADLTGADLSEAIMIEVEAVRMCAKGANLSQTDLEGAKLSKATLAG
FT                   ATMDETNLEAADMTSADLSRAALTNVNLNRTKLNEANLSGATLQSIVVDNIGSGVDLSG
FT                   AKLTYASINDSTFHKSDFTDADLTGSGIPQCQFRDCELSHCNMTGAELSNVDFIHKEIS
FT                   SVGEKEFASDVYGMRLDSVKCYKVYHYNSDNKPTIINGY"
     atgcttccct taccacattc tggcttattc tccagaaatc ttagtcgtaa tgatatttca        60
     ctggttaaaa atgctacaga cataggccat attggcagca gatttaaccg tattgtgaat       120
     aaagttcttg actggtgttg taataccaaa aaaacggaag ccatggagca gcttttcatc       180
     gtgatgaatc aagatcacaa ccaaagcaat aaggcaagat gtgaggcttt tgatcagcta       240
     caagaactcg ttggaagcgc gcatagtgat agatttacca aaaaatacga tgtcgtggac       300
     aattgtatca aattcaatat agatattgat ggggaggaga atttcatcac ccttactaaa       360
     gatgatttct ttgagggtct gaatttatcc ggcgcggact tgaccgacat ttcgctacaa       420
     aatggaaaac ttgggtatgt ggatctgagc ggagcgaagc tggaccatgc gaatctgacc       480
     ggcgcgcagc tgagcttcgc gaacctgagc ggagcaacgc tggaccatgc ggatctgacc       540
     ggcgcgcagc tgagcttcgc gaagctgagc ggtgcgagtc tgaacaatgc gactctgaat       600
     caggcagata tggataacgc ggatttaagc aatgcgacgc tgaatcaggc ggtgctgaag       660
     aacgtaaatc taagttcagc gattctgcgt caggcgaagt tgaatgacgc ggatctgacc       720
     ggcgcagatt tgagcgaggc gataatgatt gaagtagaag cggtgcggat gtgcgcaaag       780
     ggtgcaaatc tcagccagac ggacctggag ggcgcgaagt tgagcaaggc gactctggcc       840
     ggggccacta tggatgaaac gaatctggag gcggcggata tgaccagcgc ggacctgagt       900
     cgtgcggcct tgaccaacgt gaatttgaac cgtacgaagc tgaatgaggc gaacctgtcc       960
     ggggctacgc tgcagagtat cgtggtggat aatatcggct caggggtgga cctgagtggc      1020
     gcgaaactga cgtatgccag catcaatgat tccacgtttc acaagtccga ttttaccgat      1080
     gccgatctca ctggttcggg aataccacag tgtcagtttc gcgattgtga gttatctcat      1140
     tgcaatatga ctggggcgga attgtcaaat gtagatttca tacataaaga aatcagttca      1200
     gtcggtgaaa aggaattcgc aagcgatgtg tatggcatga gattggatag cgtgaagtgt      1260
     tacaaggttt atcactacaa ctcagataac aaaccgacaa ttattaacgg ctattaa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page