(data stored in ACNUC7421 zone)

EMBL: CP001600.PE594

CP001600.PE594       Location/Qualifiers
FT   CDS_pept        complement(631432..631614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0643"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67866"
FT                   /db_xref="UniProtKB/TrEMBL:C5B792"
FT                   /protein_id="ACR67866.1"
FT                   /translation="MNARHRYVSYELRKEIAAGETSAQVKSALHGHILDKFNCIDVQIM
FT                   PPHFVMQPKEAVQVH"
     atgaatgcaa gacacaggta tgtcagctat gagctacgga aagagattgc cgcaggagag        60
     acgtcggcgc aggtaaaaag tgcactgcac gggcacattc tggataagtt taactgcatt       120
     gacgtccaaa ttatgcctcc acattttgtt atgcagccaa aagaggcggt acaggttcat       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page