(data stored in ACNUC7421 zone)

EMBL: CP001600.PE596

CP001600.PE596       Location/Qualifiers
FT   CDS_pept        complement(631884..632243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0645"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67868"
FT                   /db_xref="GOA:C5B794"
FT                   /db_xref="UniProtKB/TrEMBL:C5B794"
FT                   /protein_id="ACR67868.1"
FT                   /translation="MQDLIAASPDLLSPTSIALLIQRPLRLLFRQVESGRLRLPGFYPD
FT                   TIKTTRRQLSVIIWMFALSMPYPFFPCANTRVFKSVSVFLGLMITQDSAGLVSLAMSGL
FT                   IQISSLVLHQGIMFA"
     ttgcaggatc tgatcgccgc gtctccggat ctgctgagcc ctacctcgat cgcgctgctg        60
     atccaacgcc cattgcgcct gctgttccgc caggtggaga gcggacgcct caggctgccg       120
     gggttctacc cggataccat caagaccact cgccgccaac tcagcgtcat tatctggatg       180
     tttgctctgt cgatgcccta tcccttcttc ccttgcgcca atacccgggt gtttaagagc       240
     gtcagcgtct ttttgggact gatgatcacg caggactcag cgggtctggt cagccttgcc       300
     atgagcggcc tgatccagat ctcgtcactc gtcttacacc aggggattat gttcgcatag       360
//

If you have problems or comments...

PBIL Back to PBIL home page