(data stored in ACNUC7421 zone)

EMBL: CP001600.PE597

CP001600.PE597       Location/Qualifiers
FT   CDS_pept        complement(632322..632441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67869"
FT                   /db_xref="UniProtKB/TrEMBL:C5B795"
FT                   /protein_id="ACR67869.1"
FT                   /translation="MQKQIRRHADILIMQAPLSPTLATLSVAYRPIAGYTWLV"
     ttgcaaaaac agatccgccg ccatgccgat attcttatca tgcaggctcc cttatcacct        60
     acattggcaa ccttgagcgt cgcataccgg cctatcgctg gctatacctg gctggtatag       120
//

If you have problems or comments...

PBIL Back to PBIL home page