(data stored in ACNUC7421 zone)

EMBL: CP001600.PE6

CP001600.PE6         Location/Qualifiers
FT   CDS_pept        7172..8470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0006"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67268"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD0"
FT                   /protein_id="ACR67268.1"
FT                   /translation="MRHPSEVQLTHDARGHQLTNTGVWTPDSHWIAYDVRPHGGSFSGV
FT                   TIERVSVPDGQCEVIYHAGDEACVGVVTVAPTLPERYVFIHGPEHPDAQWQYDFHHRRG
FT                   AIVSADRPGQAETLDALSITAPYLPGALRGGSHVHVFSPDGSRLSFTYNDHVMHEHCPE
FT                   RDQRNIGVALPMGAVRVKKQHPREYDGSHFCVLVSATTPTPRPGSDDITRAYEEGWIGK
FT                   QGYLKEDGQHQRWALAFIGDTLDLDGRRVAELFIVDLPAEMAAYRCAGDQPLQGTLSSL
FT                   PAPPAGICQRRLTFTHQRRHPGLATVPRHWVRSAPDGSAIAFLMRDEQGVVQLWLISPN
FT                   GGEARQITHGAHDVQSAFNWHPDGRSVLMVMDNSVVRCDVASGAVTRITGRTAQPPCAD
FT                   AVIPSPDGRWVAYMREVNGWTQIFVARLTSDGE"
     atgcgtcatc cttcagaagt acagctgacc cacgatgccc gtggacatca gttgaccaat        60
     accggcgttt ggactccgga tagccactgg atcgcttacg atgtccgccc acacggtggc       120
     tcgtttagcg gcgtgaccat tgagcgggtc agcgtgccgg atggacagtg cgaggttatc       180
     tatcatgccg gcgatgaggc ctgtgtcggt gtggtcacgg tagcgccgac gctgccggag       240
     cgctatgttt tcatccatgg tccggagcat cccgatgcgc agtggcagta tgacttccat       300
     catcggcgtg gcgccatcgt tagcgccgat cgccctggcc aggccgagac tctggacgcg       360
     ttatcgatca ccgctccata tctccccggg gccttgcgcg gaggttccca tgtgcatgtc       420
     ttcagcccgg atggttcacg cctgagtttt acctataacg atcatgtgat gcatgagcat       480
     tgccctgagc gcgatcagcg caacatcggg gtagccttgc cgatgggagc ggtgcgcgtg       540
     aagaaacagc acccacgcga gtatgacggc agccacttct gtgtcctggt cagtgcgacg       600
     acgccgacac cgcggcccgg tagtgatgat attacccggg cttacgaaga gggatggatc       660
     ggtaagcagg gatacctaaa agaggatggt cagcaccaac gttgggcgtt ggcatttatc       720
     ggcgatactt tggatctgga cggtcgccgc gttgcggagc tgtttatcgt cgatctaccg       780
     gcggagatgg cggcctatcg atgcgcaggg gatcaaccat tgcaggggac cctctcgtcg       840
     cttcctgcgc caccggccgg catctgccag cggcgtttaa cctttaccca tcaacggcgt       900
     catcccggcc tggcaacggt gccacgccat tgggtacgca gtgcgccgga cggcagtgct       960
     atcgctttcc tgatgaggga tgagcagggt gtggtgcagc tgtggctgat ctcacctaat      1020
     ggcggtgagg cccgccagat cacgcacggc gcgcatgatg ttcaatctgc ttttaactgg      1080
     catccggatg ggcgctcggt gctgatggtg atggataaca gcgtggtgcg ctgcgatgtg      1140
     gccagcggcg ctgtcacccg gatcaccggg cgtacggcgc agcccccctg tgctgacgcc      1200
     gtcataccgt caccggatgg ccgctgggta gcctatatgc gagaggttaa cggttggacg      1260
     caaatttttg tcgcccgtct gacctcagat ggcgagtag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page