(data stored in ACNUC7421 zone)

EMBL: CP001600.PE600

CP001600.PE600       Location/Qualifiers
FT   CDS_pept        complement(636946..637626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0649"
FT                   /product="DTW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67872"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J5"
FT                   /protein_id="ACR67872.1"
FT                   /translation="MSANAVLRLRAARLSQSTRPFHARGCRVQRCLLPQIHCLCDTLTS
FT                   YPAHSRFCLMMYDTEPLKPSNTGRLIADVLPETLAYSWSRTQPDPQLLQLLDDPDYQPY
FT                   VVFPGSYAEPERVVTRVRHNTHRPLFIMLDGTWPEARKMFHKSPYLDRFPVLSINMAQA
FT                   PGYLLREAHRPEQYCTAEVAAALLALADDRQASQGLLQHFHHFRQQYLLGKSHPQVPVA
FT                   ATVE"
     atgtccgcca atgctgtact gcgcctgcgc gctgcgcgtc tgagccagtc tacccgccca        60
     tttcacgccc gcggctgccg tgtacagcgc tgcctgctgc cgcagatcca ctgcctgtgt       120
     gatacgctga ccagctaccc ggcccacagc cgcttttgcc tgatgatgta tgataccgaa       180
     ccgctaaaac ccagcaatac cgggcgcctg atcgccgatg tactgccgga aacactggcc       240
     tatagctggt cccggacgca gccggatcca cagctgctgc agctgctcga cgatcccgac       300
     taccagccgt acgtggtctt tccaggaagc tacgcagagc cagagcgcgt cgtcacccgc       360
     gtacgacaca atacgcaccg cccgctgttt atcatgctgg atggaacctg gccggaggca       420
     cgcaaaatgt tccacaaaag cccctatctg gacaggttcc cagtcctctc catcaatatg       480
     gcacaggcac ctggctatct tctgcgggag gcccatcgcc cagagcagta ctgtaccgcc       540
     gaagtcgctg cggcgctgct ggcactggcg gacgatcggc aggcatcgca gggactgctt       600
     cagcactttc accacttccg tcagcaatat ttgctaggta aatcgcaccc tcaggtgccc       660
     gtcgctgcaa ccgtggaata a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page