(data stored in ACNUC7421 zone)

EMBL: CP001600.PE605

CP001600.PE605       Location/Qualifiers
FT   CDS_pept        640387..640731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0654"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67877"
FT                   /db_xref="GOA:C5B7K0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K0"
FT                   /protein_id="ACR67877.2"
FT                   /translation="MGYHVGEKLQTENVVKAFRQALRRRKTTGPPVHHSDRGVQYCSAL
FT                   YQSIHERNGVTCSMTDGYDCYQNALAERINGILKNTFLPSCPADLAQARTMVKESVDIY
FT                   NHERPHLALK"
     atggggtatc atgtagggga aaaactgcag actgaaaatg tggtgaaagc gttcaggcag        60
     gcactgaggc ggagaaaaac gacaggtcct ccggtacatc actcggacag aggagtgcaa       120
     tactgttcag cgctttatca gtcaatacat gaaagaaacg gggtaacctg ttcaatgacc       180
     gatggttatg actgttacca gaatgcgttg gcagagcgga taaacggtat cctgaaaaat       240
     acgtttttac cctcatgccc ggcggatctt gcgcaggcca gaacaatggt aaaagaatct       300
     gtagatattt ataaccatga gaggccacat ctagcgctga aatag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page