(data stored in ACNUC7421 zone)

EMBL: CP001600.PE606

CP001600.PE606       Location/Qualifiers
FT   CDS_pept        complement(640819..641535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0655"
FT                   /product="aerobic respiration control protein ArcA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67878"
FT                   /db_xref="GOA:C5B7K1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K1"
FT                   /protein_id="ACR67878.1"
FT                   /translation="MQTPHILIVEDELVTRNTLKSIFEAEGYIVHEANDGAEMHQILSE
FT                   FDINLVIMDINLPGKNGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLGSGTEERKSVEHYRFNGWELDINSRSLVSPDGEQYKLPR
FT                   SEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
     atgcagaccc cgcacattct gatcgtcgag gacgaactcg tcactcgtaa tacgctaaaa        60
     agtattttcg aagcggaagg ttatatcgtt catgaagcca atgatggtgc cgaaatgcat       120
     cagattctgt ctgagttcga catcaatctg gtcatcatgg acattaacct gcctgggaaa       180
     aacggcctgt tactggcgcg cgaactgcgt gaacaggcaa atgtcgcgct gatgttcctg       240
     accggtcgcg ataacgaagt ggacaaaatc ctcggcctgg aaatcggcgc cgatgattat       300
     atcactaagc cgtttaaccc ccgtgaactg accatccgcg cccgcaacct gctctcccgc       360
     accatgaacc tgggcagcgg aaccgaagaa cgtaaaagtg ttgagcacta tcgctttaat       420
     ggctgggagc tggacatcaa cagccgctcg ctggtcagcc ccgacggcga gcagtacaag       480
     ctgccgcgca gcgagttccg cgccatgctg cacttctgcg agaatccggg caagattcag       540
     tcacgcgccg agctgctgaa gaagatgact ggccgtgagc tgaagccgca cgatcgtacg       600
     gtcgacgtca cgatccgccg tattcgcaag cactttgaat caacgccgga cacgccagag       660
     atcatcgcca ctatccatgg cgaaggctac cgcttctgcg gcgatttgga agagtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page