(data stored in ACNUC7421 zone)

EMBL: CP001600.PE610

CP001600.PE610       Location/Qualifiers
FT   CDS_pept        645724..646653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0660"
FT                   /product="homoserine kinase, putative"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67882"
FT                   /db_xref="GOA:C5B7K5"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7K5"
FT                   /protein_id="ACR67882.1"
FT                   /translation="MVKIYAPASIGNVSIGFDVLGAAVTPLDGTLLGDCVSIAASSHFS
FT                   LHCHGRFVDSLPSTVQENIVYQCWQRFCEVTGRELAVEMVLEKNMPIGSGLGSSACSVV
FT                   AALAALNRFAGEPLDAHRLLMLMGELEGRISGSVHYDNVAPCYLGGLQLMLEAQEIISQ
FT                   PVPCFDEWLWVMAYPGIKVSTAEARAILPPHYSRGDCVRHGRHLAGFIHACHTRQPSLA
FT                   AALMQDVIAEPYRCGLLPGFADARRAAGELGALACGISGSGPTLFAVCDDLTAAQAVAQ
FT                   WLAQHYLQNEQGFVHICRLDSAGARQLG"
     atggtgaaaa tatatgcacc ggcctcaatc ggcaacgtca gcatcggctt tgacgtcctc        60
     ggcgctgcgg tcacgccgct ggacggtacc ctgctgggcg actgcgtcag catcgcggcc       120
     agcagccatt tttcgttgca ctgccacggg cgttttgttg acagcctgcc gtctacggtg       180
     caggagaata ttgtctatca gtgctggcag cgtttttgtg aggtgacggg acgcgagctt       240
     gccgtcgaaa tggtgttgga aaagaacatg ccgataggtt caggccttgg ctcaagcgcc       300
     tgctccgtgg tggcggcgct ggcggcgctg aaccgttttg ccggagagcc gctggacgct       360
     caccggctgc tgatgctgat gggggagctg gaggggcgta tttccggcag cgttcactat       420
     gacaacgtgg cgccctgtta tctgggcggt ttgcaactga tgctggaggc gcaggagatc       480
     atcagccagc cggtgccctg ctttgacgaa tggctgtggg tgatggcgta tcccgggatc       540
     aaggtctcta ccgccgaggc gcgcgccatc ctaccgccgc actattcgcg cggcgactgc       600
     gtgcgccacg gccgccatct ggcggggttc attcatgcct gtcatacccg tcagccgtcg       660
     ctggccgcgg cgttgatgca ggatgtgatc gccgaaccct accgctgtgg tctgctgccg       720
     ggctttgccg atgcccgccg ggccgccggt gagctgggcg cgttggcctg tgggatctct       780
     ggctccggtc caacgctgtt tgccgtttgc gatgatctga cggcggcaca ggcggtggcg       840
     cagtggctgg cgcagcacta tctgcagaat gaacagggtt ttgttcacat ttgccgtttg       900
     gactcggcgg gcgcacgaca actgggataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page