(data stored in ACNUC7421 zone)

EMBL: CP001600.PE612

CP001600.PE612       Location/Qualifiers
FT   CDS_pept        complement(648004..648801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0662"
FT                   /product="Protein of unknown function (DUF328)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67884"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7K7"
FT                   /protein_id="ACR67884.1"
FT                   /translation="MLMIISPAKTLDYTSPLAIQRYTQPQMLAQAETLMQTVRTLTPAQ
FT                   LGSLMKISDKLAGLNAARFTEWQPSFTPENARQAILAFKGDVYTGLQAETFSEQDFDFA
FT                   QRHLCMLSGLYGVLRPLDLMMPYRLEMGTRLHTPYGNDLYAFWGDSITRQINQQLLQQG
FT                   DRVVVNLASDEYFKAVRPAALEGELIKPIFMDEKNGSMKVISFYAKKARGMMSRFIIQA
FT                   RLREPEQLKAFDLEGYAFAGETQGRQGRELLFTRRHSAISPAR"
     atgctgatga ttatctctcc ggctaaaacg ttggattaca cctctccgct ggccatccag        60
     cgctataccc agccgcaaat gctggcgcag gccgaaaccc tgatgcagac agtacgcaca       120
     ctgacgccgg cacagctggg ttcgctgatg aaaatcagcg acaagctggc cgggctaaac       180
     gctgcccgct tcaccgagtg gcagcccagc ttcacgccgg aaaacgcccg tcaggccatc       240
     ctggccttca agggtgacgt ctacaccgga ctccaggcgg agacgttcag cgagcaggac       300
     tttgactttg cccaacgaca cctgtgcatg ctgtcaggcc tatatggcgt gctgcgcccg       360
     ctggatctga tgatgcccta ccgcctggag atgggaaccc gtctacatac tccatacggc       420
     aacgatctgt acgccttctg gggcgacagc atcacccggc agatcaacca gcagctgctg       480
     cagcagggcg atcgggtcgt cgttaatctg gcctcagacg aatactttaa ggcagtcaga       540
     ccggcggcgc tggagggcga gctgattaag ccgatcttta tggatgagaa gaatggcagc       600
     atgaaggtca tcagcttcta cgccaagaag gcgcgcggga tgatgagccg ctttattatc       660
     caggcgcgcc tgcgcgagcc ggagcagctc aaggcattcg atctggaggg ctatgccttt       720
     gccggtgaaa cgcagggacg ccaagggcgc gagctgctgt ttacccgtcg ccactcggcg       780
     atatcccccg cgcgctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page