(data stored in ACNUC7421 zone)

EMBL: CP001600.PE613

CP001600.PE613       Location/Qualifiers
FT   CDS_pept        complement(648911..649453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0663"
FT                   /product="amino acid carrier protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67885"
FT                   /db_xref="GOA:C5B7K8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K8"
FT                   /protein_id="ACR67885.2"
FT                   /translation="MQMLGVFMDTLVICSATAAIILSSGVLDAAPGTISGIELTQRALS
FT                   SAVGDWGGIFIAVAIFFFAFTSIIANYAYAESNLIFLEHNHPHGLVFLRLCTLGMVMFG
FT                   ALAELPLVWKMADLSMALMAITNLIAILLLSGVAFKLARDYNHQRRLGLLPRLDLSKYP
FT                   EIQQQVEPGIWEKPTRP"
     gtgcagatgc tgggggtctt tatggatacg ctggttatct gcagcgcgac tgccgccatc        60
     atcctctcct ccggcgtcct ggacgcggcg ccgggcacca tcagcggcat tgagctgacc       120
     cagcgggcgc tctcctccgc tgtcggcgac tggggcggca tatttatcgc cgtcgccatt       180
     ttcttcttcg ccttcacctc gatcatcgca aactatgcct atgcggagag caatctgatc       240
     tttctggagc acaaccatcc gcacggcctg gttttcctac gcctgtgtac gctgggcatg       300
     gtgatgttcg gcgcgctggc ggagctgccc ctcgtctgga aaatggccga tctctccatg       360
     gccctgatgg cgataaccaa cctgatcgcc atcctgctgc tgtcgggcgt tgccttcaag       420
     ctggcgcgtg actataacca ccagcgtcgt ctggggctgc tgccgaggct ggacctcagc       480
     aagtatcccg agatccagca gcaggttgaa cccggtatct gggaaaagcc aacgcggccg       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page