(data stored in ACNUC7421 zone)

EMBL: CP001600.PE614

CP001600.PE614       Location/Qualifiers
FT   CDS_pept        complement(649341..650351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0664"
FT                   /product="amino acid carrier protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67886"
FT                   /db_xref="GOA:C5B7K9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K9"
FT                   /protein_id="ACR67886.1"
FT                   /translation="MTDLISFINNILWGSVLIYLLIGAGLYFTFRTGFIQFRHFGHMFS
FT                   VLKNSNKADSGGISSFQALCTSLAARVGTGNLTGVAIALTAGGPGAIFWMWIIALIGMA
FT                   TSFIESTLAQLYKTRDDQGNFRGGPAYYMEKGLGMRWMGILFSLFLLVAFGLVFNAVQA
FT                   NSIAQATAVAFHIPPLYVGIALMLMCGVVIFGGLRSIARTAELVVPVMAIAYLLLAFWV
FT                   MGHNLARMPEVLLLVLKSAFGLQEAAAGAIGYGISQAMTQGIQRGLFSNEAGMGSAPNA
FT                   AASATPYPVSAAPRLAGLCADAGGLYGYAGYLQRDCRHHPLLRRPGRGAGHHQRH"
     ttgacggatc tcattagttt tatcaataac atcttatggg gctcggtact gatctatctg        60
     ctgatcggcg caggcctgta tttcacgttc cgcaccgggt ttattcagtt tcgccatttt       120
     ggccacatgt tttctgttct gaaaaacagc aacaaggccg acagcggcgg tatctcctcc       180
     tttcaggcgc tgtgtaccag cctggccgca cgcgtcggca cgggtaatct gaccggcgtc       240
     gccatcgcgc tgaccgccgg tgggccgggc gccatcttct ggatgtggat catcgccctg       300
     atcggcatgg ccacctcctt tattgagagc accctggcac agctgtacaa gacccgcgac       360
     gatcagggca acttccgcgg cggcccggcc tactatatgg aaaaggggct tggcatgcgc       420
     tggatgggga tcctgttctc gctgtttctg ttggttgcct ttggactggt cttcaatgcg       480
     gtgcaggcca actccatcgc acaggcgacg gccgttgcct tccatattcc gccactgtac       540
     gtcggcatcg cgctgatgct gatgtgcggc gtcgtcatct ttggcggcct gcgttcgatt       600
     gcccgaaccg ccgaactggt ggtgccggtc atggccattg cctatctgct gctggcattc       660
     tgggtgatgg gacacaatct ggcccgaatg ccagaggtgc tactgctggt gcttaaaagc       720
     gcctttggcc tgcaggaggc cgccgccggc gccatcggct acggtatctc acaggcgatg       780
     acccaaggga tccagcgcgg gctgttctcc aacgaggccg gcatgggatc ggcgcccaat       840
     gccgcggcct ccgccacccc gtaccccgta tccgccgcac cccgcctcgc agggctatgt       900
     gcagatgctg ggggtcttta tggatacgct ggttatctgc agcgcgactg ccgccatcat       960
     cctctcctcc ggcgtcctgg acgcggcgcc gggcaccatc agcggcattg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page