(data stored in ACNUC7421 zone)

EMBL: CP001600.PE619

CP001600.PE619       Location/Qualifiers
FT   CDS_pept        654142..654729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0669"
FT                   /product="putative molybdopterin binding domain protein"
FT                   /note="Probable molybdopterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67891"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L4"
FT                   /protein_id="ACR67891.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDLGIPALETWLASALATPYTLESR
FT                   LIPDEQPLIEQTLCELVDERGCHLVLTSGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QVSLRFVPTAILSRQVGVIRKQALIINLPGQPKSIRETLEGLKDGDGNTVVHGIFASVP
FT                   YCIQLLDGPYVETHPAVIAAFRPKSARRETID"
     atgaatacac tacgcatcgg tttagtatcg atctctgaca gggcatccag cggtgtctat        60
     caggaccttg ggatcccggc gttggagacg tggctggcca gcgcactggc taccccttat       120
     accctggagt cccggctgat cccggacgaa cagccgctga tcgaacagac cctgtgtgag       180
     ctggtggatg aacgcggctg tcatctggtg ttgacctccg gtggtacagg cccggcgcgg       240
     cgtgacgtga cgccggacgc cacgctggcg gttgccgatc gcgaaatgcc ggggtttggt       300
     gagcagatgc gtcaggttag cctgcgcttt gttccgacgg cgatcctgtc gcgtcaggtg       360
     ggagtgattc gtaaacaggc gctgatcatc aatctgccgg gtcagccgaa gtcgatccgc       420
     gaaacgctgg aggggctgaa ggatggggat gggaatacgg tcgttcacgg gatctttgcc       480
     agtgtgccgt actgcatcca gttgctggat ggcccctacg tagaaaccca cccggctgta       540
     atagcagcat ttcggccgaa aagcgcccgt cgcgaaacaa ttgactga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page