(data stored in ACNUC7421 zone)

EMBL: CP001600.PE621

CP001600.PE621       Location/Qualifiers
FT   CDS_pept        complement(656250..656753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0671"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67893"
FT                   /db_xref="GOA:C5B7L6"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L6"
FT                   /protein_id="ACR67893.1"
FT                   /translation="MLNLHNAGLFPLTSVILAMGIFFGGIAQILAGLMEYKKGNTFGLT
FT                   AFTAYGSFWLTLAALLTLPKMGLAEATDALSLGTYLALWGIFTLFMFFGTLRGNRVLQF
FT                   VFASLTVLFFLLAYGNITANASVLHIAGIEGIICGASAIYLAMAEVINEQYGRDVLPIG
FT                   AKHA"
     ttgctgaacc tgcacaacgc agggctcttt ccgctgactt ccgttattct ggcgatgggg        60
     attttctttg gcggtatcgc ccagatcctg gccggactga tggagtataa gaagggcaat       120
     acctttggac tgaccgcgtt taccgcctat ggctcctttt ggctgactct ggcggcactg       180
     ctgacgctgc ccaagatggg gctggccgag gctaccgacg ccctgtcgct agggacttat       240
     ttggcgctat ggggcatctt taccctgttt atgttctttg gcaccctgcg cggcaaccgt       300
     gtcctgcagt ttgtcttcgc cagcctgacc gtactgttct ttctgttggc ctatggcaac       360
     atcacggcga acgccagcgt gctgcatatc gccggcattg aagggattat ctgcggcgcc       420
     agcgctatct atctggcgat ggccgaggtg attaacgagc aatatggccg ggacgtattg       480
     ccgatcggcg ctaagcacgc ctaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page