(data stored in ACNUC7421 zone)

EMBL: CP001600.PE622

CP001600.PE622       Location/Qualifiers
FT   CDS_pept        657136..659043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0672"
FT                   /product="chaperone protein DnaK, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67894"
FT                   /db_xref="GOA:C5B7L7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L7"
FT                   /protein_id="ACR67894.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGGKARVLENAEGDRTTPSIIAYTQD
FT                   GEVLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDAEAQRDKDIMPYKIVAADNGDAWVE
FT                   VKDQKIAPPQISAEVLKKMKKTAEDFLGETVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGMDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEELVARSMEPLKVALKDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLSEDEIKQMVR
FT                   DAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPATDKSAIEEAVKALEAAS
FT                   KGEDKADIEAKIQALVQSSAKLQELAQQQAQAGEAQADTSAKKDDDVVDAEFEEVKDKK
FT                   "
     atgggtaaaa tcattggtat cgacctgggt acaactaact cttgtgtagc agttatggat        60
     ggcggcaagg cccgcgttct ggagaatgct gagggcgatc gcaccacgcc ctccatcatc       120
     gcctatacac aggatgggga agttctggtt ggccagccgg caaagcgcca ggcggtcacc       180
     aacccgcaaa acacgctgtt tgcgatcaaa cgcttgatcg gccgtcgttt tgaagatgcc       240
     gaagcacagc gtgataaaga catcatgccc tataagatcg tggcagctga taacggcgac       300
     gcatgggtag aagtgaaaga ccagaagatc gcgccgccgc agatctctgc cgaagtcctg       360
     aagaaaatga agaaaacggc ggaagatttt ctgggtgaga cggtgactga ggcggtcatt       420
     accgtaccag cttactttaa cgacgcgcag cgccaggcga ccaaagacgc tggtcgtatc       480
     gccggtctgg atgtgaagcg tatcatcaac gagccgaccg cggccgcgct ggcctacggc       540
     atggacaaag gggtgggtaa ccgcactatc gctgtctatg acctgggtgg cggtactttc       600
     gatatctcca tcatcgaaat cgatgatgtc gatggcgaaa agaccttcga agttctggcg       660
     accaatggtg atacccatct gggcggggaa gattttgata gccgtctgat caactacctg       720
     gtcgatgagt ttaagaaaga gcagggtatt gacctgcgca acgatccgct ggcgatgcag       780
     cgtctgaaag aagcggctga aaaagcgaag attgagctct cctctgctca gcagaccgac       840
     gtgaacctgc cgtatatcac cgcagatgcc accggtccga agcatatgaa catcaaggtg       900
     acccgcgcta aactggagtc cctggtcgaa gagctggttg cccgttccat ggagccgctg       960
     aaggtagctc tgaaggatgc cggtctgtct gtctctgaca tcgacgacgt gatcctggtg      1020
     ggcggtcaga cccgtatgcc gatggtgcag aagcaggttg cagatttctt cggtaaagaa      1080
     ccgcgtaaag acgttaaccc ggatgaagct gtggccatcg gtgccgctgt tcagggggga      1140
     gtactggcgg gtgatgtgaa ggatgtattg ctgctggacg ttaccccgct gtctttgggt      1200
     atcgaaacta tgggcggcgt catgacggcg ttgatctcta agaacaccac cattccgacc      1260
     aagcatagtc aggtgttctc taccgctgaa gacaaccagt ctgccgtgac catccatgtc      1320
     ctgcagggtg agcgtaagcg tgcggcggat aacaagtctc tgggtcagtt caacctggat      1380
     ggtattcagc cggcgccgcg cggtatgccg cagatcgaag tcaccttcga catcgacgcc      1440
     gacggtatcc tgcatgtctc cgcgaaggat aagaacagtg ggcgtgagca gaacatcacc      1500
     atcaaggctt cttctggtct gagcgaagat gagatcaagc agatggtgcg tgacgccgag      1560
     gccaacgccg aagcggatcg caagttcgaa gagctggttc aggtgcgtaa ccaggccgat      1620
     cagctggtgc atggcacccg caagctggtg gaagaagcgg gcgacaaact gccggcgact      1680
     gacaagagcg cgatcgaaga ggcggtgaag gcgctggaag cggccagcaa gggtgaggat      1740
     aaggcggata tcgaagccaa aatccaggcg ctggtacagt cttctgccaa gctgcaggag      1800
     ttggcgcagc agcaggccca ggccggtgaa gcgcaggcgg acaccagcgc caagaaagat      1860
     gacgacgtgg ttgacgccga attcgaagaa gtaaaagata aaaaataa                   1908
//

If you have problems or comments...

PBIL Back to PBIL home page