(data stored in ACNUC7421 zone)

EMBL: CP001600.PE623

CP001600.PE623       Location/Qualifiers
FT   CDS_pept        659154..660287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0673"
FT                   /product="chaperone protein DnaJ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67895"
FT                   /db_xref="GOA:C5B7L8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L8"
FT                   /protein_id="ACR67895.1"
FT                   /translation="MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAED
FT                   KFKEIKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGGGFGGGADFSDIFGDVFGDIF
FT                   GGGRRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLAECDVCHGSGAKKGSEPITCP
FT                   TCHGAGQVQMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGVD
FT                   TGDRIRLAGEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGEI
FT                   EVPTLDGRVNLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQKQ
FT                   LLRELEESFGGPASDKNSPRSKRFFDGVKKFFDDLTR"
     atggcgaaga aagactacta tgagattttg ggcgtatccc gtgaagcgga tgagcgcgaa        60
     atcaaaaaag cctataaacg cctggccatg aagtatcacc ctgaccgtaa tcagggcgat       120
     aaagaggccg aggacaagtt taaggaaatc aaagaagcct atgaaatcct gaccgatgcg       180
     cagaagcgtg cggcctacga tcagtacggc catgcggcgt ttgagcaggg cggcatgggc       240
     ggcggcggcg gtggtttcgg cggcggtgcg gatttcagtg acatcttcgg cgacgtgttc       300
     ggcgacatct tcggcggcgg tcgtcgccag cgcgcggcgc gcggcgcgga tctgcgttac       360
     aacatggatc tgacgctgga ggaggcggta cgtggcgtca ccaaagagat ccggattccg       420
     accttggctg agtgcgatgt ctgccacggc agcggtgcca agaagggcag tgagccgatc       480
     acctgcccga cctgccatgg tgccggtcag gtacagatgc gccagggctt cttcaccgta       540
     cagcagcctt gtccgcactg ccacgggcgc ggcactatta ttaaagatcc gtgcaataag       600
     tgtcacggcc acggccggat tgaaaaatcc aaaaccctgt cggtgaaaat tcctgccggg       660
     gtcgataccg gtgatcgcat ccgcctggcg ggcgagggtg aggctgggga gaacggggcg       720
     ccggccggcg atctgtatgt tcaggtgcag gtgaaggcac atccgatttt tgagcgggaa       780
     gataataacc tgttctgcga ggtgccgatc aacttcgcga tggcggcgct gggcggtgag       840
     attgaggtgc cgaccctgga tgggcgggtt aatctgaaga tcccggccga gacccagacc       900
     ggcaagatgt tccgtatgcg tggccggggg gtgaagtcgg tgcgtggcgg ggcgcagggt       960
     gacttgctgt gccgtgtggt ggtcgagacg ccggtgaacc tgaacgataa acagaaacag      1020
     ctgctgcgtg agctggagga gagctttggc ggccccgcca gtgataagaa tagcccccgc      1080
     tccaagcgtt ttttcgacgg ggtgaagaaa ttctttgatg atctgactcg ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page