(data stored in ACNUC7421 zone)

EMBL: CP001600.PE625

CP001600.PE625       Location/Qualifiers
FT   CDS_pept        661903..662805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0675"
FT                   /product="transcriptional activator protein NhaR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67897"
FT                   /db_xref="GOA:C5B7M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M0"
FT                   /protein_id="ACR67897.1"
FT                   /translation="MRLSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLGGKLFKRQGRGLVPSELGQLVFRYADRMFMLSQEMLDIVNYRKESSMLFDVGVADA
FT                   LSKRLVSQVLETAVADHEQIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECGVSFFCRQPLPEMPFPTCLEQRKLLIPGRRSMLGRKLLNWFNSQGLQVQILG
FT                   EFDDAALMKAFGLYHDAIFVAPSIYAQDMYANVQDNIREVGRIDNVQEEYYVIFAERMI
FT                   QHPAVQRVCNKDFSALFSR"
     gtgcgtctgt cacatataaa tttcaatcat ctctattact tctggcaagt gtgtaaagag        60
     gggtcggtgg tcggggccgc ggaggcgctg tttctgacgc cgcagaccat taccgggcag       120
     attaaggcgc tggaagagcg cttaggcggc aagctgttta agcgccaggg gcgcggcctg       180
     gtgccttctg agctggggca gctggtattc cgctatgccg atcgcatgtt tatgctcagc       240
     caagagatgc tggatattgt taattatcgc aaagagtcca gcatgctgtt tgacgtcggc       300
     gtagccgatg cgctctctaa acggttggtg agccaggtgc tggagacggc ggtagccgac       360
     catgagcaga tccacctgcg ctgctttgag tcgactcacg agctgttgct ggagcagctg       420
     agccagcaca agctggatat gatcctgtcg gattgcccgg tggactccag tcagcaggag       480
     gggctgtttt ccgtcaagct cggtgagtgt ggcgtcagct tcttctgtcg tcagccgctg       540
     ccagagatgc cgttcccgac ctgcctggag cagcgtaagc tgttaattcc gggacgtcgc       600
     tctatgctgg gacgcaagct gttgaactgg tttaacagcc aggggttaca ggtgcagatc       660
     ctcggtgagt ttgatgacgc cgcgctgatg aaggcgtttg gcctgtatca cgatgccatt       720
     tttgtcgctc cgtcgattta tgcgcaggat atgtacgcca acgtgcagga caatatccgc       780
     gaggtgggac gcatcgacaa tgtgcaggaa gagtattacg tgatctttgc cgagcggatg       840
     attcagcatc cggctgtaca gcgggtatgc aacaaggact tttcagcgct gttcagccgt       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page