(data stored in ACNUC7421 zone)

EMBL: CP001600.PE626

CP001600.PE626       Location/Qualifiers
FT   CDS_pept        662914..663123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0676"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67898"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M1"
FT                   /protein_id="ACR67898.2"
FT                   /translation="MTSSFILVDQAFVCLTVDDRLHVVVRCLSSCFVASSDSCVYFLDE
FT                   STHHGTAASIVLATLFRLNGAFLS"
     atgacgagca gctttattct tgtggatcag gcctttgttt gcctgacggt cgacgatcgg        60
     ctgcatgtcg ttgtacgctg cctgagcagc tgctttgtcg ccagtagcga tagctgcgta       120
     tactttcttg atgaaagtac gcatcatgga acggcggcta gcattgtgct tgcgacgctt       180
     ttcagactga acggcgcgtt tcttagctga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page