(data stored in ACNUC7421 zone)

EMBL: CP001600.PE627

CP001600.PE627       Location/Qualifiers
FT   CDS_pept        complement(663211..663402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67899"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M2"
FT                   /protein_id="ACR67899.1"
FT                   /translation="MERHRYRLCTSGDHLAPIHHCQMAMMGKIARNAVFHTTKLVKFGA
FT                   IETHGCRHYKRRLFAQIH"
     ttggaacggc atcgctaccg cctgtgcacc agcggcgacc atttagcccc catccaccat        60
     tgtcagatgg ccatgatggg aaaaatcgcg cgaaacgctg tattccacac aacaaagctg       120
     gtaaaattcg gcgccattga aacgcacggg tgtcgccact acaagcggcg cttatttgca       180
     caaatccatt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page