(data stored in ACNUC7421 zone)

EMBL: CP001600.PE628

CP001600.PE628       Location/Qualifiers
FT   CDS_pept        663550..664545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0678"
FT                   /product="riboflavin biosynthesis protein RibF, putative"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67900"
FT                   /db_xref="GOA:C5B7M3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M3"
FT                   /protein_id="ACR67900.1"
FT                   /translation="MELIRGTHNLRARHRGCVLTIGNFDGVHRGHRALLARLRQEGDRL
FT                   GVPVMVMIFEPQPLEMFAPQNAPARLTRLRDKCRYLADAGVDAVLCVGFDRQFASHSAQ
FT                   DFVKHLLVERLGVKFLMIGDDFRFGAGREGDYQMLQAAGKVYGFTVTNSLSFCVGDRRV
FT                   SSTAVRHALRHDDLALAESLLGHPYRIAGRVVHGDALGRTIGFPTANLPLKRLVAPVKG
FT                   VYAVDVYGLGPTPLPGVANIGTRPTVAGIRQQLEVHLLDVTMDLYGRHIDVVLRAKLRN
FT                   EQRFDSLDALKRQIAQDVVAAREFFWADNTGPEPDGSIPIVENGTEIEDE"
     atggagctaa ttcgcggcac tcataaccta cgcgcgcggc atcgtggctg tgtgctgacc        60
     atcggcaact ttgacggcgt gcaccggggg catcgggcgc tgctggcgcg tctgcgtcag       120
     gagggcgatc gtcttggggt gccggtgatg gtgatgatct ttgagcccca gcctctggag       180
     atgttcgcgc cgcagaatgc gccagcccgc ttgacgcgcc tgcgggataa gtgccgctat       240
     ctggccgacg ccggggtgga tgccgtgctg tgtgtgggtt ttgaccgcca gttcgccagc       300
     cattcggctc aggattttgt gaaacacctg ctggtcgagc gcctcggggt gaagtttttg       360
     atgattggcg atgattttcg ctttggcgcc gggcgtgagg gggattacca gatgctgcag       420
     gccgccggaa aagtctatgg gtttaccgtc actaacagcc tcagcttttg tgtcggtgat       480
     cggcgggtca gcagtaccgc ggtgcgtcac gcgctgcgcc acgatgacct ggcactggcg       540
     gaaagcctgc tgggccaccc ctatcgcatt gccgggcggg tggttcatgg cgatgcgctg       600
     gggcgtacca tcggtttccc caccgccaat ctaccgctaa aacggctggt cgcgccggta       660
     aaaggtgttt atgccgtaga tgtttatgga ctgggtccca cgcctttgcc gggcgtggcc       720
     aatatcggta cccgtccgac cgtcgctggc atacgccagc agctggaggt ccatctgctt       780
     gatgtgacga tggatctcta tgggcgccat attgatgtgg tgctccgcgc aaaactgcgc       840
     aatgaacagc gttttgattc gcttgatgca ctgaagcggc aaatcgccca agatgtggtg       900
     gctgcccgcg aatttttttg ggctgacaac accggtccag agcctgatgg ctcaatccca       960
     atagtcgaaa acggaaccga aatcgaagat gagtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page