(data stored in ACNUC7421 zone)

EMBL: CP001600.PE63

CP001600.PE63        Location/Qualifiers
FT   CDS_pept        57470..58441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0066"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67326"
FT                   /db_xref="GOA:C5BB91"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB91"
FT                   /protein_id="ACR67326.1"
FT                   /translation="MSHPGFIITIDTEGDNLWQNHDRITTENARYLPRFQLLCEKYGFK
FT                   PVYLTNYEMASDPVYVEFARDVIARGCGEVGMHLHAWNSPPEIPLTDNDWANKPYLIEY
FT                   PAEVIRQKVDYMTHLLEDTFQTKMVSHRAGRWAMNAFYLQLLLEHGYQIDCSVTPRVDW
FT                   RGARGAPQGNGGSDYSGYPDHAYFVDAADLRREGSTALLEVPMSTRLKHDPLFNHLRGA
FT                   YDRLRGKRRPPSVQWLRPRGGNLQEMQRVAEYHLSLGRDYVEFMLHSSEFMPGGSPTFR
FT                   SGQDIERLYHDLEALFDWLAPQVKGQTLAEYYQIKRGQRPAR"
     atgagccatc ctgggtttat cattaccatt gacaccgaag gtgataatct gtggcaaaac        60
     cacgatcgga ttaccacaga gaatgcccgc tatttgcctc gattccagct gctgtgtgag       120
     aaatatggtt ttaagccggt ctatttgacc aattatgaaa tggccagcga tccggtttat       180
     gttgaatttg cccgggacgt gatcgcccgg ggatgcggtg aggtcgggat gcacctgcat       240
     gcctggaaca gtccgccgga gattccgctg acggataatg actgggccaa taaaccttat       300
     ttaatcgaat atcctgcaga ggtaatccgg caaaaagtgg attacatgac gcacctgctg       360
     gaggatacct tccagacgaa aatggtgagc catcgtgcgg gtcgctgggc gatgaatgct       420
     ttttatttgc agctgttgtt ggagcatggc tatcagatag attgctcagt cacgccgcgc       480
     gtcgattggc gtggcgctcg cggtgcaccg caggggaacg gcggcagtga ctacagcggc       540
     tatccggacc acgcttattt tgtggacgct gctgatttac gccgtgaggg ctccaccgcc       600
     ctgctggaag tgccgatgag tacccggttg aagcatgatc cgctgtttaa tcacctgcgc       660
     ggtgcctatg atcgcctgcg gggtaagcgt cgtccgccgt cagtgcagtg gctgcgtccg       720
     cgcggtggga acctgcagga gatgcagcgg gtggcggagt atcatctgtc cctggggcgt       780
     gattatgtag aatttatgct gcattcctct gagtttatgc ccggaggaag cccgaccttc       840
     cggagtgggc aggatatcga acggctgtat cacgatctgg aggcgctgtt tgactggctg       900
     gcgcctcagg tgaaagggca gacgctggcg gagtattatc agataaaacg tggtcagcgc       960
     ccggcgaggt aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page