(data stored in ACNUC7421 zone)

EMBL: CP001600.PE633

CP001600.PE633       Location/Qualifiers
FT   CDS_pept        complement(669368..669922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0683"
FT                   /product="conserved hypothetical protein TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67905"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M8"
FT                   /protein_id="ACR67905.1"
FT                   /translation="MFTKKALACLLVAGGLSLSAQAMTLSSPSVDNGKSLQNVQIFNGW
FT                   GCTGQNKSPALTWSDVPAGTKSFAVTMYDPDAPTGSGWWHWMMIDIPASVHSLAQNVGE
FT                   KESRDLPKGAIQLRNDFGYNGFGGACPPPGAKPHNYQITVYALNVAKLDIPAHASPAYA
FT                   GYFILQHKIGEARLTAPTNMR"
     atgtttacca agaaagcact cgcttgcctg ctggttgccg ggggacttag cctcagcgcc        60
     caggcaatga cgctcagtag tccctcagtt gacaatggta agtcgctaca gaacgtacag       120
     atttttaatg gctggggctg taccgggcag aataaatcac cggcgctgac ctggagtgat       180
     gtaccggcgg gcaccaagag ttttgccgtc accatgtatg atccggatgc accaacaggc       240
     agcggatggt ggcactggat gatgatcgac attcccgcct cagtacatag cctggcacaa       300
     aacgtcggag agaaagagag ccgcgatctg cccaagggcg caatccagct gcgcaatgac       360
     tttggctata acggctttgg cggcgcctgt cctcctccgg gagccaagcc ccataactac       420
     caaatcaccg tatatgcact gaatgtcgcg aagttagaca ttcctgccca cgcttctccc       480
     gcctatgccg gctacttcat cttgcagcat aaaatcggcg aagcccgcct gacggcaccg       540
     accaatatgc gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page