(data stored in ACNUC7421 zone)

EMBL: CP001600.PE634

CP001600.PE634       Location/Qualifiers
FT   CDS_pept        complement(670113..670601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0684"
FT                   /product="xanthine dehydrogenase, Fe-S subunit, putative"
FT                   /EC_number="1.17.1.4"
FT                   /note="xanthine dehydrogenase, Fe-S subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67906"
FT                   /db_xref="GOA:C5B7M9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M9"
FT                   /protein_id="ACR67906.1"
FT                   /translation="MNVKEWVEIRCQINGKTYQFCVSPAISLLEMLREHGLTSVKQGCC
FT                   VGECGACSVLIDGVATDSCLYLALWADGKQIVTAEGLGRADSLSPIQQAYVDAGAVQCG
FT                   FCTPGLVVATHALLAKPRSRPLTHQEIRRGLSGNLCRCTGYQAIVRAVDLCQHEEEEQ"
     atgaatgtca aagagtgggt tgagatccgc tgccagatca atgggaaaac ctatcagttt        60
     tgcgtgtcgc cggcgatatc actgctggaa atgctgcgcg agcacgggct aaccagcgtg       120
     aagcagggct gctgcgtcgg tgagtgcggc gcctgcagcg tattgatcga tggcgtggca       180
     accgacagct gcctgtatct ggcgctgtgg gcagatggta agcaaatcgt cacggccgaa       240
     ggactgggcc gagccgacag cctttctccg atccagcagg cctatgtcga cgccggcgct       300
     gtgcagtgcg gtttctgtac tccgggactg gtggtcgcga cccatgccct gctggcaaaa       360
     ccgcgcagtc gcccgctgac gcatcaagag atccgccgcg gcctctccgg caacctgtgc       420
     cgctgtaccg gctatcaggc catcgtacgc gccgtcgatc tctgccagca cgaagaagag       480
     gagcagtag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page