(data stored in ACNUC7421 zone)

EMBL: CP001600.PE635

CP001600.PE635       Location/Qualifiers
FT   CDS_pept        complement(670598..671476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0685"
FT                   /product="xanthine dehydrogenase, FAD-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67907"
FT                   /db_xref="GOA:C5B7N0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N0"
FT                   /protein_id="ACR67907.1"
FT                   /translation="MYDIKRYLRATSARHASELMLAHPDSRLLAGGTDVLIQLHHHNAQ
FT                   YAHIVDIHGLPELCGITMLEDGSLRIGSGTTFTQLIEHPLIQMHLPMLAEAAATIAGPQ
FT                   IRNVATYGGNICNGATSADSAAPSVALKAQLEILTPDGVTIRPIDGFHTGPGKVALTPG
FT                   EILLAFRFHPNDHRHAGSAYIKYAMRGAMDIATIGCAALCRIESGRFSELRLAYGVAAP
FT                   TPIRCPQAESCANGQPLSRQTLAAVAAAVAADVSPRSSWRAEKEFRLHLIRTLAQRAIT
FT                   LAVQRAGGDIL"
     atgtatgata ttaaacgcta cctgcgcgcc accagcgcgc gccatgccag cgagctgatg        60
     ctggcccacc cggacagccg gctgctggcg ggcggcaccg acgtgctgat ccagctgcac       120
     caccataacg cgcagtacgc ccatatcgtg gatatccacg ggctacccga gctgtgcggc       180
     attacgatgc tagaggatgg ctccctacgc atcggctcag gcaccacctt tacccagctc       240
     atcgagcacc cgctgatcca gatgcacctg ccaatgctgg ctgaagccgc cgccaccatc       300
     gccggtccgc agatccgcaa cgtcgccacc tacggcggta acatctgcaa cggtgccacc       360
     agcgcagact ccgctgcccc cagcgtcgcg ctcaaggccc agctggagat cctgacgcct       420
     gatggcgtaa cgatccgtcc gatcgacggc tttcataccg ggccggggaa ggtggcgctg       480
     acccctggtg agatcctgct ggccttccgc tttcatccca acgatcaccg ccacgctggc       540
     agcgcctata tcaagtacgc catgcgcggt gcgatggata ttgccaccat cggctgtgca       600
     gcgctgtgtc gcattgagtc tggacgcttc agcgagctgc gtctggctta cggcgtcgcg       660
     gcaccgacgc cgatccgctg cccgcaggcc gagtcctgcg ccaacggcca gccgctgagc       720
     cgccagacgc tggccgccgt cgctgccgcc gtcgccgctg acgtttcgcc acgctcatcc       780
     tggcgcgcag aaaaggaatt ccgtttacac ctgatccgca ccctggcaca gcgggccatt       840
     accctggccg tgcagcgtgc gggaggagat atactatga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page